Transcription Factor

						

			
Accessions: 6ncm_B (3D-footprint 20231221)

			
Names: Checkpoint suppressor 1, Forkhead box protein N3, FOXN3_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O00409
Length: 87
Pfam Domains:      3-82 Fork head domain
Sequence: 
(in bold interface residues)		   1 NCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKC   60
  61 FKKVDGSLWCIDPEYRQNLIQALKKTP
Interface Residues: 43, 46, 48, 49, 50, 52, 53, 54, 55, 56, 57, 58, 59, 65
3D-footprint Homologues: 3l2c_A, 7vox_H, 2hdc_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 3g73_A, 6ako_C, 7yzg_A, 7tdw_A, 7yz7_A, 6el8_A, 2uzk_A, 7tdx_A, 2a07_J, 7yzb_A, 6nce_A, 3co6_C, 3qrf_G, 3w6v_A
Binding Motifs: 6ncm_AB TAGCGta
Binding Sites: 6ncm_C
6ncm_D
			
Publications: Rogers JM, Waters CT, Seegar TCM, Jarrett SM, Hallworth AN, Blacklow SC, Bulyk ML. Bispecific Forkhead Transcription Factor FoxN3 Recognizes Two Distinct Motifs with Different DNA Shapes. Mol Cell 74:245-253 (2019). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.