Transcription Factor

Accessions: T116900_1.02 (CISBP 1.02), Q9SN12 (JASPAR 2024), T13496 (AthalianaCistrome v4_May2016)
Names: AtMYB77, T116900_1.02;, AT3g50060/F3A4_140, AtMYBR2, Myb domain protein 77, MYB transcription factor, Myb-related protein 77, Myb-related protein R2, MYB77_ARATH, Q9SN12_ARATH, R2R3-MYB transcription factor, Transcription factor MYB77, AT3G50060, MYB77, T13496;
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Uniprot: Q9SN12
Notes: experiment type:PBM, family:Myb/SANT, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:MYB
Length: 301
Pfam Domains: 6-51 Myb-like DNA-binding domain
9-67 Myb-like DNA-binding domain
60-102 Myb-like DNA-binding domain
61-109 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRP 60
61 FSPEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETE 120
121 EDQDRPKKRRSVSFDSAFAPVDTGLYMSPESPNGIDVSDSSTIPSPSSPVAQLFKPMPIS 180
181 GGFTVVPQPLPVEMSSSSEDPPTSLSLSLPGAENTSSSHNNNNNALMFPRFESQMKINVE 240
241 ERGEGRRGEFMTVVQEMIKAEVRSYMAEMQKTSGGFVVGGLYESGGNGGFRDCGVITPKV 300
301 E
Interface Residues: 6, 40, 41, 42, 43, 45, 46, 49, 50, 51, 92, 93, 96, 97, 100, 101, 102
3D-footprint Homologues: 1vfc_A, 2kdz_A, 7xur_A, 5eyb_B, 6kks_A, 3osg_A, 7c4r_A, 1mse_C, 3zqc_A
Binding Motifs: MA0575.1 madyGACrGTTRs
M1330_1.02 GrCrGTTr
M0493 ydrwwwwdaCsGTTA
M0576 bkTwwdwTACGGTTACGGTT
MA0575.2 GACrGTTRs
Publications: Romero I., Fuertes A., Benito M. J., Malpica J., Leyva A., Paz-Ares J. More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana. Plant J. 14:273-284 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.