Transcription Factor

Accessions: MADS73 (EEADannot 2026-03-04)
Names: ZmMADS73;MADS73;Zm00001eb255670_P001
Organisms: Zea mays
Libraries: EEADannot 2026-03-04 1
1 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed]
Notes: family:MADS box factors Type II
Length: 167
Pfam Domains: 29-110 K-box region
Sequence: MNEIIDKYNTHSKNLGKTEQPSLDLNLEHSKYANLNEQLAEASLRLRQMRGEELEGLNVE
ELQQLEKNLESGLHRVLQTKDQQFLEQINDLERKSTQLAEENMQLRNQVSQIPPAGKQAV
ADTENVIAEEGQSSESVMTALHSGSSQDNDDGSDVSLKLGLPCVAWK
Binding Motifs: EEAD0437 CTTTCCTwwTT
EEAD0438 TGACTAATTAGGAAA
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.