Transcription Factor

						

			
Accessions: PBX4_TF1 (HumanTF2 1.0)

			
Names: Homeobox protein PBX4, PBX4, PBX4_HUMAN, Pre-B-cell leukemia transcription factor 4
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: Q9BYU1
Notes: Ensembl ID: ENSG00000105717; Construct type: TF1(SBP); TF family: HomeodomainTALE; Clone source: Gene synthesis
Length: 119
Pfam Domains:      1-19 PBC domain
    21-80 Homeobox domain
    39-77 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 QLKQSTCEAVMTLRSRLLDARRKRRNFSKQATEVLNEYFYSHLNNPYPSEEAKEELARKG   60
  61 GLTISQVSNWFGNKRIRYKKNMGKFQEEATIYTGKTAVDTTEVGVPGNHASCLSTPSSG
Interface Residues: 5, 21, 22, 23, 24, 25, 65, 66, 68, 69, 72, 73, 76, 77, 80
3D-footprint Homologues: 1au7_A, 3d1n_M, 5zfz_A, 6fqp_B, 1puf_A, 1fjl_B, 3cmy_A, 6a8r_A, 1zq3_P, 1jgg_B, 2lkx_A, 2ld5_A, 1b72_A, 4cyc_A, 3l1p_A, 5zjt_E, 5hod_A, 1puf_B, 5jlw_D, 4j19_B, 7q3o_C, 1le8_A, 1ig7_A, 4xrm_B, 2hdd_A, 1le8_B, 6m3d_C, 2r5y_A, 6es3_K, 4xrs_G, 1mnm_C, 7psx_B, 1du0_A, 3a01_E, 2d5v_B, 1k61_B, 5flv_I, 3lnq_A, 4qtr_D, 2h1k_B, 6fqq_E, 3rkq_B, 8g87_X, 2hos_A
Binding Motifs: PBX4_HOXA1 vymATmAATCA-
PBX4_HOXA10_1 ccATAAATCA-
PBX4_HOXA10_2 vtcrTAAATCa-
PBX4_HOXA10_2_3 cycrTAAATCamTCa
			
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.