Transcription Factor

Accessions: 6y93_A (3D-footprint 20241219)
Names: NOC_BACSU, Nucleoid occlusion protein
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P37524
Length: 105
Pfam Domains: 13-37 Helix-turn-helix
21-59 KorB domain
Sequence:
(in bold interface residues)
1 ELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPQPVQEAIMEKKITE 60
61 RHARALIPLKQPELQVTLLTEIIEKSLNVKQTEDRVVKMLEQGQR
Interface Residues: 22, 23, 32, 33, 34, 35, 37, 38, 41, 61, 64, 89, 90, 93
3D-footprint Homologues: 6t1f_B, 7jvt_D, 6s6h_A, 7ol9_B, 6y93_B, 1rio_A
Binding Motifs: 6y93_AB TATTTCCngGGAAATA
Binding Sites: 6y93_C / 6y93_D
Publications: Jalal ASB, Tran NT, Stevenson CE, Chan EW, Lo R, Tan X, Noy A, Lawson DM, Le TBK. Diversification of DNA-Binding Specificity by Permissive and Specificity-Switching Mutations in the ParB/Noc Protein Family. Cell Rep 32:107928 (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.