Transcription Factor
| Accessions: | 6y93_A (3D-footprint 20231221) |
| Names: | NOC_BACSU, Nucleoid occlusion protein |
| Organisms: | Bacillus subtilis, strain 168 |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P37524 |
| Length: | 105 |
| Pfam Domains: | 13-37 Helix-turn-helix 21-59 KorB domain |
| Sequence: (in bold interface residues) | 1 ELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPQPVQEAIMEKKITE 60 61 RHARALIPLKQPELQVTLLTEIIEKSLNVKQTEDRVVKMLEQGQR |
| Interface Residues: | 22, 23, 32, 33, 34, 35, 37, 38, 41, 61, 64, 89, 90, 93 |
| 3D-footprint Homologues: | 6t1f_B, 7jvt_D, 6s6h_A, 3bdn_A, 4umk_D, 3mzh_A, 6y93_B, 1rio_A, 7ol9_B |
| Binding Motifs: | 6y93_AB TATTTCCngGGAAATA |
| Binding Sites: | 6y93_C / 6y93_D |
| Publications: | Jalal ASB, Tran NT, Stevenson CE, Chan EW, Lo R, Tan X, Noy A, Lawson DM, Le TBK. Diversification of DNA-Binding Specificity by Permissive and Specificity-Switching Mutations in the ParB/Noc Protein Family. Cell Rep 32:107928 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.