Transcription Factor
| Accessions: | NFYB_HUMAN (HOCOMOCO 10), P25208 (JASPAR 2024) |
| Names: | CAAT box DNA-binding protein subunit B, NF-YB, NFYB_HUMAN, Nuclear transcription factor Y subunit beta |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 207 |
| Pfam Domains: | 58-122 Histone-like transcription factor (CBF/NF-Y) and archaeal histone 59-122 Core histone H2A/H2B/H3/H4 |
| Sequence: (in bold interface residues) | 1 MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP 60 61 IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF 120 121 AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT 180 181 TDGQQQNVMVYTTSYQQISGVQQIQFS |
| Interface Residues: | 40, 42, 44, 46, 50, 51, 53, 56, 58, 62, 77, 79, 80, 84, 88, 90, 148 |
| 3D-footprint Homologues: | 4efj_A, 2vla_A, 4g92_B, 4awl_B, 6r2v_B, 5t5k_E, 7cvo_B, 1jfi_B |
| Binding Motifs: | MA0502.1 rmmysrrCCAATCAG NFYB_HUMAN.H10MO.A|M01369 yrrCCAATsrgmr MA0502.2 cyCATTGGCCar MA0502.3 yCATTGGCC |
| Binding Sites: | MA0502.1.1 MA0502.1.10 MA0502.1.11 MA0502.1.12 MA0502.1.13 MA0502.1.14 MA0502.1.15 MA0502.1.16 MA0502.1.17 MA0502.1.18 MA0502.1.19 MA0502.1.2 MA0502.1.20 MA0502.1.3 MA0502.1.4 MA0502.1.5 MA0502.1.6 MA0502.1.7 MA0502.1.8 MA0502.1.9 MA0502.2.1 MA0502.2.10 MA0502.2.11 / MA0502.2.8 MA0502.2.12 MA0502.2.13 MA0502.2.14 / MA0502.2.9 MA0502.2.10 / MA0502.2.15 MA0502.2.11 / MA0502.2.16 MA0502.2.12 / MA0502.2.17 MA0502.2.13 / MA0502.2.18 MA0502.2.19 MA0502.2.2 MA0502.2.20 MA0502.2.1 / MA0502.2.3 MA0502.2.4 MA0502.2.3 / MA0502.2.5 MA0502.2.4 / MA0502.2.6 MA0502.2.5 / MA0502.2.7 MA0502.2.6 / MA0502.2.8 MA0502.2.9 MA0502.2.14 MA0502.2.15 MA0502.2.16 MA0502.2.17 MA0502.2.18 MA0502.2.19 MA0502.2.2 MA0502.2.20 MA0502.2.7 MA0502.3.1 / MA0502.3.19 MA0502.3.10 / MA0502.3.13 / MA0502.3.9 MA0502.3.11 / MA0502.3.5 MA0502.3.12 MA0502.3.14 MA0502.3.15 MA0502.3.16 MA0502.3.17 MA0502.3.18 MA0502.3.2 / MA0502.3.7 MA0502.3.20 MA0502.3.3 / MA0502.3.6 MA0502.3.4 MA0502.3.8 |
| Publications: | Bi W, Wu L, Coustry F, de Crombrugghe B, Maity S.N. DNA binding specificity of the CCAAT-binding factor CBF/NF-Y. The Journal of biological chemistry 272:26562-72 (1997). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.