Transcription Factor

						

			
Accessions: 5jvt_A (3D-footprint 20231221)

			
Names: FLI1_HUMAN, Friend leukemia integration 1 transcription factor, Proto-oncogene Fli-1, Transcription factor ERGB
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q01543
Length: 96
Pfam Domains:      2-84 Ets-domain
Sequence: 
(in bold interface residues)		   1 GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRA   60
  61 LRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPT
Interface Residues: 55, 56, 58, 59, 60, 62, 63, 77
3D-footprint Homologues: 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A
Binding Motifs: 5jvt_A tTCCg
5jvt_AD TTCCGnnGgnnCGGAa
Binding Sites: 5jvt_B / 5jvt_E
5jvt_C / 5jvt_F
			
Publications: Hou C, Weidenbach S, Cano KE, Wang Z, Mitra P, Ivanov DN, Rohr J, Tsodikov OV. Structures of mithramycin analogues bound to DNA and implications for targeting transcription factor FLI1. Nucleic Acids Res 44:8990-9004 (2016). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.