Transcription Factor

Accessions: 3l2c_A (3D-footprint 20241219)
Names: Fork head domain transcription factor AFX1, Forkhead box protein O4, FOXO4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P98177
Length: 85
Pfam Domains: 8-84 Fork head domain
Sequence:
(in bold interface residues)
1 RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRH 60
61 NLSLHSKFIKVHNEATGKSSWWMLN
Interface Residues: 24, 26, 28, 31, 33, 52, 53, 55, 56, 57, 59, 60, 61, 63, 64, 73, 78
3D-footprint Homologues: 8vms_A, 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 7tdx_A, 2a07_J, 8sro_B
Binding Motifs: 3l2c_A GTAAACA
Binding Sites: 3l2c_B
3l2c_C
Publications: Boura E, Rezabkova L, Brynda J, Obsilova V, Obsil T. Structure of the human FOXO4-DBD-DNA complex at 1.9 Å resolution reveals new details of FOXO binding to the DNA. Acta crystallographica. Section D, Biological crystallography 66:1351-7 (2010). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.