Transcription Factor
| Accessions: | 3l2c_A (3D-footprint 20260701) |
| Names: | Fork head domain transcription factor AFX1, Forkhead box protein O4, FOXO4_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P98177 |
| Length: | 85 |
| Pfam Domains: | 8-84 Fork head domain |
| Sequence: (in bold interface residues) | 1 RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRH 60 61 NLSLHSKFIKVHNEATGKSSWWMLN |
| Interface Residues: | 28, 50, 52, 53, 55, 56, 57, 59, 60, 61, 63, 64, 73, 78 |
| 3D-footprint Homologues: | 8vfz_O, 3l2c_A, 8bzm_E, 7vox_H, 2hdc_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 8sro_B, 3qrf_G |
| Binding Motifs: | 3l2c_A GTAAACA |
| Binding Sites: | 3l2c_B 3l2c_C |
| Publications: | Boura E, Rezabkova L, Brynda J, Obsilova V, Obsil T. Structure of the human FOXO4-DBD-DNA complex at 1.9 Å resolution reveals new details of FOXO binding to the DNA. Acta crystallographica. Section D, Biological crystallography 66:1351-7 (2010). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.