Transcription Factor

Accessions: 6od3_A (3D-footprint 20250804), 6od3_E (3D-footprint 20250804), 6od5_D (3D-footprint 20250804)
Names: bHLHb19, Class B basic helix-loop-helix protein 19, Immunoglobulin transcription factor 2, ITF-2, ITF2_HUMAN, SEF-2, SL3-3 enhancer factor 2, TCF-4, Transcription factor 4
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P15884
Length: 62
Pfam Domains: 3-56 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVR 60
61 ER
Interface Residues: 4, 7, 8, 10, 11, 12, 14, 15
3D-footprint Homologues: 8osb_B, 2ypa_A, 7z5k_B, 6od3_F, 2ql2_D, 7d8t_A, 2ypa_B, 2ql2_A, 6g1l_A
Binding Motifs: 6od5_CD CACGTG
6od3_ABH CACGTG
6od3_EF CACGTgnm
Binding Sites: 6od5_E
6od5_F
Publications: Yang J, Horton JR, Li J, Huang Y, Zhang X, Blumenthal RM, Cheng X. Structural basis for preferential binding of human TCF4 to DNA containing 5-carboxylcytosine. Nucleic Acids Res 47:8375-8387 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.