Transcription Factor
Accessions: | 5zko_A (3D-footprint 20231221), 5zko_C (3D-footprint 20231221) |
Names: | cAMP-responsive element-binding protein 1, CREB-1, CREB1_HUMAN, Cyclic AMP-responsive element-binding protein 1 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P16220 |
Length: | 53 |
Pfam Domains: | 1-52 bZIP transcription factor 3-49 Basic region leucine zipper |
Sequence: (in bold interface residues) | 1 KREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYC |
Interface Residues: | 5, 9, 10, 12, 13, 16, 17 |
3D-footprint Homologues: | 4eot_A, 2wt7_B, 7x5e_F, 5t01_B, 1dh3_C, 5vpe_D |
Binding Motifs: | 5zko_ACGH GCTGACGTCAGC |
Binding Sites: | 5zko_B / 5zko_D |
Publications: | Song Y, Zhai L, Valencia Swain J, Chen Y, Wang P, Chen L, Liu Y, Xiang S. Structural Insights into the CRTC2-CREB Complex Assembly on CRE. J Mol Biol 430:1926-1939 (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.