Transcription Factor

Accessions: 5zko_A (3D-footprint 20231221), 5zko_C (3D-footprint 20231221)
Names: cAMP-responsive element-binding protein 1, CREB-1, CREB1_HUMAN, Cyclic AMP-responsive element-binding protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P16220
Length: 53
Pfam Domains: 1-52 bZIP transcription factor
3-49 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 KREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYC
Interface Residues: 5, 9, 10, 12, 13, 16, 17
3D-footprint Homologues: 4eot_A, 2wt7_B, 5t01_B, 1dh3_C, 5vpe_D, 7x5e_F
Binding Motifs: 5zko_ACGH GCTGACGTCAGC
Binding Sites: 5zko_B / 5zko_D
Publications: Song Y, Zhai L, Valencia Swain J, Chen Y, Wang P, Chen L, Liu Y, Xiang S. Structural Insights into the CRTC2-CREB Complex Assembly on CRE. J Mol Biol 430:1926-1939 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.