Transcription Factor

						

			
Accessions: 5ke8_A (3D-footprint 20231221)

			
Names: Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4_MOUSE, Krueppel-like factor 4
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q60793
Length: 85
Pfam Domains:      2-26 C2H2-type zinc finger
     2-26 Zinc finger, C2H2 type
    18-40 Zinc-finger double domain
    32-56 C2H2-type zinc finger
    32-56 Zinc finger, C2H2 type
    49-73 Zinc-finger double domain
    62-84 C2H2-type zinc finger
    62-84 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDPLTRHYRKHTGHR   60
  61 PFQCQKCDRAFSRSDHLALHMKRHF
Interface Residues: 14, 15, 16, 17, 18, 20, 21, 23, 24, 27, 44, 45, 46, 47, 48, 50, 51, 52, 55, 65, 66, 68, 69, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83
3D-footprint Homologues: 6jnm_A, 8cuc_F, 1tf3_A, 3uk3_C, 6ml4_A, 7n5w_A, 5kkq_D, 8ssu_A, 2i13_A, 1llm_D, 6u9q_A, 4x9j_A, 1ubd_C, 5kl3_A, 7ysf_A, 1mey_C, 6wmi_A, 5ei9_F, 7w1m_H, 5und_A, 2kmk_A, 7eyi_G, 8ssq_A, 2gli_A, 1g2f_F, 1tf6_A, 6blw_A, 8h9h_G, 5v3j_F, 7y3m_I, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 5k5i_A, 7y3l_A, 5yel_A, 8gn3_A, 7txc_E, 5yj3_D, 2wbs_A, 2drp_D, 1f2i_J, 4m9v_C, 2stt_A, 4bqa_A, 4l18_B, 4lg0_B, 8gh6_A
Binding Motifs: 5ke8_A gcCAnnCCT
Binding Sites: 5ke8_B
5ke8_C
			
Publications: Hashimoto H, Wang D, Steves AN, Jin P, Blumenthal RM, Zhang X, Cheng X. Distinctive Klf4 mutants determine preference for DNA methylation status. Nucleic Acids Res 44:10177-10185 (2016). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.