Transcription Factor
Accessions: | ELF2_TF2 (HumanTF2 1.0), ELF2 (HT-SELEX2 May2017) |
Names: | E74-like factor 2, ELF2, ELF2_HUMAN, ETS-related transcription factor Elf-2, New ETS-related factor, ENSG00000109381 |
Organisms: | Homo sapiens |
Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q15723 |
Notes: | Ensembl ID: ENSG00000109381; Construct type: TF2(3xFLAG); TF family: ETS; Clone source: MGC, TF family: ETS experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: ETS experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: ETS experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: ETS experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
Length: | 145 |
Pfam Domains: | 27-109 Ets-domain |
Sequence: (in bold interface residues) | 1 TQQSPISNGSPELGIKKKPREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLV 60 61 DSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVIDD 120 121 DKSETCNEDLAGTTDEKSLERVSLS |
Interface Residues: | 81, 82, 85, 86, 88, 89, 103 |
3D-footprint Homologues: | 8smh_F, 7jsa_J, 8smj_F, 8ee9_F, 1yo5_C, 8rev_A |
Binding Motifs: | ELF2_1 awmCCGGAAGTr ELF2_2 aAtsCGGAAGTr ELF2_3 raygCGGAAGTr ELF2_4 wamsCGGAAGTr ELF2_7 aACCCGGAAGTr ELF2_8 aAtsCGGAAGTr ELF2_methyl_1 rAysCGGAAGTr ELF2_methyl_2 aAmCmGGAAGTr ELF2_methyl_5 AAcCmGGAAGTr ELF2_methyl_6 AAysCGGAAGTr |
Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.