Transcription Factor
Accessions: | vfl (FlyZincFinger 1.0 ) |
Names: | CG12701 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 141 |
Pfam Domains: | 38-61 Zinc-finger double domain 52-74 C2H2-type zinc finger 52-74 Zinc finger, C2H2 type 67-92 Zinc-finger double domain 81-104 C2H2-type zinc finger 81-104 Zinc finger, C2H2 type 95-119 Zinc-finger double domain 110-132 Zinc finger, C2H2 type 111-130 Zinc-finger of C2H2 type 112-133 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 KRRRNSSVGSTSPHSTTLPSGRIKCLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKR 60 61 FQSEDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFC 120 121 RKDHLRKHLETHNRPRVVGKK |
Interface Residues: | 33, 34, 35, 36, 37, 39, 40, 42, 43, 44, 47, 52, 62, 63, 64, 65, 66, 67, 68, 69, 70, 73, 91, 92, 93, 94, 95, 96, 97, 98, 99, 102, 120, 121, 122, 123, 124, 125, 126, 127, 128 |
3D-footprint Homologues: | 6jnm_A, 1tf3_A, 5v3j_F, 7n5w_A, 1ubd_C, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 8ssu_A, 6ml4_A, 5kkq_D, 1tf6_A, 7eyi_G, 8h9h_G, 7ysf_A, 6wmi_A, 2lt7_A, 7y3m_I, 2i13_A, 6a57_A, 2jpa_A, 2kmk_A, 3uk3_C, 1mey_C, 2drp_D, 2gli_A, 1g2f_F, 6u9q_A, 5yel_A, 4x9j_A, 1llm_D, 6e94_A, 5k5i_A, 6blw_A, 8cuc_F, 7y3l_A, 5kl3_A, 2wbs_A, 1f2i_J, 8gn3_A, 7txc_E, 4m9v_C, 5yj3_D |
Binding Motifs: | vfl_SANGER_5_FBgn0259789 gCAGGTAG vfl_SOLEXA_5_FBgn0259789 kkkbkCAGGTAGsyg |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.