Transcription Factor

Accessions: vfl (FlyZincFinger 1.0 )
Names: CG12701
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 141
Pfam Domains: 38-61 Zinc-finger double domain
52-74 C2H2-type zinc finger
52-74 Zinc finger, C2H2 type
67-92 Zinc-finger double domain
81-104 C2H2-type zinc finger
81-104 Zinc finger, C2H2 type
95-119 Zinc-finger double domain
110-132 Zinc finger, C2H2 type
111-130 Zinc-finger of C2H2 type
112-133 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KRRRNSSVGSTSPHSTTLPSGRIKCLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKR 60
61 FQSEDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFC 120
121 RKDHLRKHLETHNRPRVVGKK
Interface Residues: 33, 34, 35, 36, 37, 39, 40, 42, 43, 44, 47, 52, 62, 63, 64, 65, 66, 67, 68, 69, 70, 73, 91, 92, 93, 94, 95, 96, 97, 98, 99, 102, 120, 121, 122, 123, 124, 125, 126, 127, 128
3D-footprint Homologues: 6jnm_A, 1tf3_A, 5v3j_F, 7n5w_A, 1ubd_C, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 8ssu_A, 6ml4_A, 5kkq_D, 1tf6_A, 7eyi_G, 8h9h_G, 7ysf_A, 6wmi_A, 2lt7_A, 7y3m_I, 2i13_A, 6a57_A, 2jpa_A, 2kmk_A, 3uk3_C, 1mey_C, 2drp_D, 2gli_A, 1g2f_F, 6u9q_A, 5yel_A, 4x9j_A, 1llm_D, 6e94_A, 5k5i_A, 6blw_A, 8cuc_F, 7y3l_A, 5kl3_A, 2wbs_A, 1f2i_J, 8gn3_A, 7txc_E, 4m9v_C, 5yj3_D
Binding Motifs: vfl_SANGER_5_FBgn0259789 gCAGGTAG
vfl_SOLEXA_5_FBgn0259789 kkkbkCAGGTAGsyg
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.