Transcription Factor
| Accessions: | 6ido_B (3D-footprint 20260701) |
| Names: | DNA-directed RNA polymerase subunit beta, EC 2.7.7.6, RNA polymerase sigma factor RpoS,RNA polymerase beta-flap-tip-helix, RNAP subunit beta, RPOB_KLEP7, Transcriptase subunit beta |
| Organisms: | Klebsiella pneumoniae subsp. pneumoniae, strain ATCC 700721 / MGH 78578 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 77 |
| Pfam Domains: | 6-59 Sigma-70, region 4 |
| Sequence: (in bold interface residues) | 1 QSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREI 60 61 LQGTQLTPEEKLLRAIF |
| Interface Residues: | 32, 33, 42, 43, 44, 45, 47, 48 |
| 3D-footprint Homologues: | 3n97_A, 6ido_B, 8cyf_B, 4pxi_B, 8sva_T, 8svd_T, 6wpa_A |
| Binding Motifs: | 6ido_B CTtGAC |
| Binding Sites: | 6ido_E 6ido_F |
| Publications: | Lou YC, Chou CC, Yeh HH, Chien CY, Sadotra S, Hsu CH, Chen C. Structural basis for -35 element recognition by σ(4) chimera proteins and their interactions with PmrA response regulator. Proteins 88:69-81 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.