Transcription Factor
| Accessions: | NR2F6_DBD (HumanTF 1.0), NR2F6 (HT-SELEX2 May2017) |
| Names: | EAR-2, NR2F6, NR2F6_HUMAN, Nuclear receptor subfamily 2 group F member 6, V-erbA-related protein 2, ENSG00000160113 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P10588 |
| Notes: | Ensembl ID: ENSG00000160113; DNA-binding domain sequence; TF family: Nuclear_Receptor; Clone source: MGC, TF family: Nuclear_receptor experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Nuclear_receptor experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 111 |
| Pfam Domains: | 19-87 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 GAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNR 60 61 DCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPP |
| Interface Residues: | 28, 29, 31, 32, 38, 39, 41, 42, 45, 46, 70, 92, 94, 96 |
| 3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A |
| Binding Motifs: | NR2F6_DBD_1 rrGGTCAAAAGGTCA NR2F6_DBD_2 rRGGTCAAAGGTCA NR2F6_3 rAGGTCAbTGACCTy NR2F6_4 rRGGTCAAAGGTCAm NR2F6_7 rrGGTCrsTGACCyy NR2F6_8 rrGGTCAaAGGTCrk NR2F6_methyl_1 rRGGTCrsyGACCYy NR2F6_methyl_2 rrGGTCAAAGGTCRh NR2F6_methyl_5 rrGGTCrsTGACCyy NR2F6_methyl_6 rrGGTcAaRGGTcrk |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.