Transcription Factor

Accessions: ALX4_DBD (HumanTF 1.0), ALX4_TF2 (HumanTF2 1.0)
Names: ALX4, ALX4_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: Q9H161
Notes: Ensembl ID: ENSG00000052850; DNA-binding domain sequence; TF family: homeodomain; Clone source: Megaman, Ensembl ID: ENSG00000052850; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013
Length: 135
Pfam Domains: 47-103 Homeobox domain
Sequence:
(in bold interface residues)
1 MADTVGMDSSYLSVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEE 60
61 LEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTA 120
121 YELPLLTRAENYAQI
Interface Residues: 46, 47, 48, 49, 50, 88, 89, 91, 92, 95, 96, 99, 100, 103
3D-footprint Homologues: 4j19_B, 2h1k_B, 1puf_A, 3cmy_A, 1fjl_B, 6a8r_A, 3d1n_M, 1ig7_A, 5zfz_A, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 1nk2_P, 1zq3_P, 2ld5_A, 3a01_E, 5flv_I, 5zjt_E, 2hdd_A, 7psx_B, 1au7_A, 5hod_A, 3rkq_B, 2r5y_A, 1puf_B, 2hos_A, 7q3o_C, 1b72_A, 5jlw_D, 4cyc_A, 6es3_K, 4xrs_G, 3l1p_A, 1e3o_C, 1le8_A, 2xsd_C, 7xrc_C, 8g87_X, 4qtr_D, 4xrm_B, 1o4x_A, 1du0_A
Binding Motifs: ALX4_DBD mTAATyhaATTAm
ALX4_EOMES skyGctAAytwwwktTvrCACmt
ALX4_TBX21_1 rgGTGykAATwawmrtysrCAsykm
ALX4_TBX21_2 AGGTGytAATwa
TEAD4_ALX4_1 GGAATGytAamytAATTa
TEAD4_ALX4_2 rCATwcCkyshTAATyrrATTA
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.