Transcription Factor

Accessions: 6ki6_B (3D-footprint 20250804)
Names: B-cell CLL/lymphoma 11A, B-cell lymphoma/leukemia 11A, BC11A_HUMAN, BCL-11A, COUP-TF-interacting protein 1, Ecotropic viral integration site 9 protein homolog, EVI-9, Zinc finger protein 856
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9H165
Length: 52
Pfam Domains: 2-23 Zinc finger, C2H2 type
3-23 C2H2-type zinc finger
15-39 Zinc-finger double domain
29-51 C2H2-type zinc finger
29-51 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 DTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHG
Interface Residues: 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 24, 26, 35, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50
3D-footprint Homologues: 7n5w_A, 5ei9_F, 6jnm_A, 3uk3_C, 2kmk_A, 1tf3_A, 7ysf_A, 8cuc_F, 7y3l_A, 5kkq_D, 1ubd_C, 8ssq_A, 1llm_D, 5kl3_A, 7txc_E, 5k5i_A, 8ssu_A, 6ml4_A, 5v3j_F, 2drp_D, 8gn3_A, 1f2i_J, 7w1m_H, 6blw_A, 5k5l_F, 2lt7_A, 6u9q_A, 4x9j_A, 2gli_A, 1g2f_F, 4m9v_C, 8h9h_G, 7y3m_I, 8gh6_A, 6e94_A, 8edg_C, 6a57_A, 2jpa_A, 1yuj_A, 2wbs_A, 5yj3_D, 1tf6_A, 5yel_A
Binding Motifs: 6ki6_B TGGTCAag
Binding Sites: 6ki6_F
6ki6_E
Publications: Yang Y, Xu Z, He C, Zhang B, Shi Y, Li F. Structural insights into the recognition of γ-globin gene promoter by BCL11A. Cell Res 29:960-963 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.