Transcription Factor
| Accessions: | 6ki6_B (3D-footprint 20250804) |
| Names: | B-cell CLL/lymphoma 11A, B-cell lymphoma/leukemia 11A, BC11A_HUMAN, BCL-11A, COUP-TF-interacting protein 1, Ecotropic viral integration site 9 protein homolog, EVI-9, Zinc finger protein 856 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9H165 |
| Length: | 52 |
| Pfam Domains: | 2-23 Zinc finger, C2H2 type 3-23 C2H2-type zinc finger 15-39 Zinc-finger double domain 29-51 Zinc finger, C2H2 type 29-51 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 DTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHG |
| Interface Residues: | 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 24, 26, 35, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50 |
| 3D-footprint Homologues: | 2kmk_A, 7ysf_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 5ei9_F, 6jnm_A, 3uk3_C, 5k5i_A, 8ssu_A, 6ml4_A, 5v3j_F, 8gn3_A, 2drp_D, 7w1m_H, 1f2i_J, 6blw_A, 5k5l_F, 2lt7_A, 6u9q_A, 4x9j_A, 2gli_A, 1g2f_F, 5kkq_D, 1ubd_C, 8ssq_A, 1llm_D, 5kl3_A, 7txc_E, 4m9v_C, 8h9h_G, 6e94_A, 7y3m_I, 8gh6_A, 8edg_C, 6a57_A, 2jpa_A, 1yuj_A, 1tf6_A, 5yel_A, 2wbs_A, 5yj3_D |
| Binding Motifs: | 6ki6_B TGGTCAag |
| Binding Sites: | 6ki6_F 6ki6_E |
| Publications: | Yang Y, Xu Z, He C, Zhang B, Shi Y, Li F. Structural insights into the recognition of γ-globin gene promoter by BCL11A. Cell Res 29:960-963 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.