Transcription Factor

						

			
Accessions: OVOL2 (HT-SELEX2 May2017)

			
Names: ENSG00000125850, OVOL2
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 159
Pfam Domains:     19-41 C2H2-type zinc finger
    19-39 Zinc finger, C2H2 type
    34-57 Zinc-finger double domain
    48-69 C2H2-type zinc finger
    49-69 Zinc finger, C2H2 type
    61-86 Zinc-finger double domain
    75-95 Zinc-finger of C2H2 type
    75-98 C2H2-type zinc finger
    75-98 Zinc finger, C2H2 type
  114-137 C2H2-type zinc finger
  114-137 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 VARSKIKFTTGTCSDSVVHSCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTF   60
  61 DLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCG  120
 121 YTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLT
Interface Residues: 29, 30, 31, 32, 33, 35, 36, 38, 39, 42, 57, 58, 59, 60, 61, 63, 64, 65, 76, 85, 86, 87, 88, 89, 90, 91, 92, 93, 96, 106, 109, 123, 124, 125, 126, 127, 128, 130, 131
3D-footprint Homologues: 6jnm_A, 5v3j_F, 6blw_A, 5kkq_D, 1ubd_C, 4x9j_A, 1mey_C, 5kl3_A, 7ysf_A, 5ei9_F, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 7eyi_G, 8ssu_A, 2i13_A, 6e94_A, 6wmi_A, 2lt7_A, 6a57_A, 2jpa_A, 7y3l_A, 7n5w_A, 1tf3_A, 3uk3_C, 8cuc_F, 1tf6_A, 6ml4_A, 1llm_D, 2wbs_A, 6u9q_A, 5yel_A, 7txc_E, 2drp_D, 1f2i_J, 5k5i_A, 4m9v_C, 8h9h_G, 7y3m_I, 8gn3_A, 3jso_B, 5yj3_D
Binding Motifs: OVOL2_2 wwwCCGYTAywyr
OVOL2_4 rwaCCGTTAydys
OVOL2_methyl_1 wwwCCGTTAtwyw
OVOL2_methyl_3 rwaCCGTTAydyg
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.