Transcription Factor
Accessions: | Q62857 (JASPAR 2024) |
Names: | C/EBP zeta, C/EBP-homologous protein, C/EBP-homologous protein 10, CCAAT/enhancer-binding protein homologous protein, CHOP, CHOP-10, DDIT-3, DDIT3_RAT, DNA damage-inducible transcript 3 protein, Growth arrest and DNA-damage-inducible protein GADD153 |
Organisms: | Rattus norvegicus |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q62857 |
Length: | 168 |
Pfam Domains: | 100-150 Basic region leucine zipper |
Sequence: (in bold interface residues) | 1 MAAESLPFAFETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL 60 61 AWLTEEPGPAEVTSTSQSPRSPDSSQSSMAQEEEEEDQGRTRKRKQSGQCAARAGKQRMK 120 121 EKEQENERKVAQLAEENERLKLEIERLTREVETTRRALIDRMVSLHQA |
Interface Residues: | 105, 108, 109, 111, 112, 115, 116 |
3D-footprint Homologues: | 8k8c_A |
Binding Motifs: | MA0019.1 rrrTGCAATmcc MA0019.2 rTGCAATmcc |
Binding Sites: | MA0019.1.1 MA0019.1.10 MA0019.1.11 MA0019.1.12 / MA0019.1.13 MA0019.1.14 MA0019.1.15 MA0019.1.16 MA0019.1.17 MA0019.1.18 MA0019.1.19 MA0019.1.2 MA0019.1.20 MA0019.1.3 MA0019.1.4 MA0019.1.5 MA0019.1.6 MA0019.1.7 MA0019.1.8 MA0019.1.9 MA0019.2.1 MA0019.2.10 / MA0019.2.11 MA0019.2.12 / MA0019.2.13 MA0019.2.14 MA0019.2.15 / MA0019.2.5 MA0019.2.16 MA0019.2.17 / MA0019.2.2 / MA0019.2.8 MA0019.2.18 MA0019.2.19 MA0019.2.20 MA0019.2.3 / MA0019.2.6 MA0019.2.4 MA0019.2.7 MA0019.2.9 |
Publications: | Ubeda M., Wang X.-Z., Zinszner H., Wu I., Habener J. F., Ron D. Stress-induced binding of the transcription factor CHOP to a novel DNA control element. Mol. Cell. Biol. 16:1479-1489 (1996). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.