Transcription Factor

Accessions: 1e3o_C (3D-footprint 20260701)
Names: NF-A1, Oct-1, Octamer-binding protein 1, OCTAMER-BINDING TRANSCRIPTION FACTOR 1, OTF-1, PO2F1_HUMAN, POU domain, class 2, transcription factor 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14859
Length: 132
Pfam Domains: 2-75 Pou domain - N-terminal to homeobox domain
75-130 Homeobox domain
Sequence:
(in bold interface residues)
1 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 60
61 SKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVW 120
121 FSNRRQKEKRIN
Interface Residues: 27, 43, 44, 45, 46, 48, 49, 55, 59, 62, 68, 73, 75, 77, 82, 83, 84, 87, 115, 116, 118, 119, 122, 123, 125, 126, 127, 130
3D-footprint Homologues: 3d1n_M, 7u0g_M, 8bx1_A, 1au7_A, 7xzz_N, 8g87_X, 2xsd_C, 7xrc_C, 3q05_B, 1o4x_A, 7xzx_N, 1e3o_C, 6crm_A, 2d5v_B, 3a01_E, 6m3d_C, 5zfz_A, 2r5y_A, 1puf_A, 2hos_A, 1b72_A, 1ig7_A, 5hod_A, 8ik5_C, 6a8r_A, 8ejp_B, 4xrs_G, 2hdd_A, 8eml_B, 2ld5_A, 5jlw_D, 7q3o_C, 1le8_A, 8osb_E, 1k61_B, 3rkq_B, 8pmf_A, 1fjl_B, 6es3_K, 5flv_I, 5zjt_E, 4cyc_A, 9b8u_A, 1zq3_P, 3lnq_A, 1nk2_P, 1du0_A, 4qtr_D, 1jgg_B, 7psx_B, 2lkx_A, 3cmy_A
Binding Motifs: 1e3o_C CATGCAT
Binding Sites: 1e3o_A
1e3o_B
Publications: Reményi A, Tomilin A, Pohl E, Lins K, Philippsen A, Reinbold R, Schöler H.R, Wilmanns M. Differential dimer activities of the transcription factor Oct-1 by DNA-induced interface swapping. Molecular cell 8:569-80 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.