Transcription Factor
Accessions: | 4ivz_A (3D-footprint 20241219), 4ivz_F (3D-footprint 20241219) |
Names: | Q8GGH0_9ENTR, Regulatory protein |
Organisms: | Enterobacter sp. RFL1396 |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q8GGH0 |
Length: | 76 |
Pfam Domains: | 12-62 Helix-turn-helix 12-62 Helix-turn-helix domain |
Sequence: (in bold interface residues) | 1 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLE 60 61 VSDVVFFEMLIKEILK |
Interface Residues: | 24, 33, 34, 35, 36, 38, 39, 45 |
3D-footprint Homologues: | 8ity_P, 3u3w_B |
Binding Motifs: | 4ivz_AF GTCGACAnTGTaGaC 4ivz_F TGTCGAC |
Binding Sites: | 4ivz_G 4ivz_D 4ivz_C 4ivz_H |
Publications: | Martin RN, McGeehan JE, Kneale G. Structural and mutagenic analysis of the RM controller protein C. Esp1396I : (PLoS). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.