Transcription Factor
Accessions: | T025971_1.02 (CISBP 1.02), CEBPG_MOUSE (HOCOMOCO 10) |
Names: | Cebpg, T025971_1.02;, C/EBP gamma, CCAAT/enhancer-binding protein gamma, CEBPG_MOUSE, GPE1-binding protein, GPE1-BP, Granulocyte colony-stimulating factor promoter element 1-binding protein, IG/EBP-1, Immunoglobulin enhancer-binding protein 1 |
Organisms: | Mus musculus |
Libraries: | CISBP 1.02 1, HOCOMOCO 10 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] |
Notes: | experiment type:PBM, family:bZIP |
Length: | 150 |
Pfam Domains: | 62-114 Basic region leucine zipper 65-120 bZIP transcription factor |
Sequence: (in bold interface residues) | 1 MSKLSQPATTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVPPSKQSKKSSPMDR 60 61 NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD 120 121 LFLEHAHSLADNVQPISTETTATNSDNPGQ |
Interface Residues: | 69, 72, 73, 75, 76, 79, 80 |
3D-footprint Homologues: | 8k8c_A, 2c9l_Z |
Binding Motifs: | M0313_1.02 krTTrcryma CEBPG_MOUSE.H10MO.C|M01035 aTKktGcAATctk |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.