Transcription Factor

						

			
Accessions: 1jk1_A (3D-footprint 20231221), 1jk2_A (3D-footprint 20231221)

			
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, ZIF268, Zinc finger protein Krox-24
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 85
Pfam Domains:      3-27 C2H2-type zinc finger
     3-27 Zinc finger, C2H2 type
    20-43 Zinc-finger double domain
    33-55 Zinc finger, C2H2 type
    33-55 C2H2-type zinc finger
    47-71 Zinc-finger double domain
    61-83 Zinc finger, C2H2 type
    61-79 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP   60
  61 FACDICGRKFARSDERKRHTKIHLR
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 41, 43, 44, 45, 46, 47, 49, 50, 51, 71, 72, 73, 74, 75, 76, 77, 78, 79
3D-footprint Homologues: 1tf3_A, 6jnm_A, 7n5w_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 8ssu_A, 1tf6_A, 6ml4_A, 4x9j_A, 2i13_A, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 5ei9_F, 2jpa_A, 1mey_C, 5kl3_A, 7ysf_A, 1f2i_J, 6wmi_A, 7eyi_G, 5v3j_F, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 2drp_D, 8cuc_F, 7y3l_A, 3uk3_C, 5k5i_A, 1llm_D, 2wbs_A, 5yel_A, 7txc_E, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: 1jk1_A cCGCCCaCGC
1jk2_A GCGtGGGC
Binding Sites: 1jk1_C
1jk1_B
1jk2_B
1jk2_C
			
Publications: Miller J.C, Pabo C.O. Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition. Journal of molecular biology 313:309-15 (2001). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.