Transcription Factor
| Accessions: | 1jk1_A (3D-footprint 20250804), 1jk2_A (3D-footprint 20250804) |
| Names: | Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, Transcription factor Zif268, ZIF268, Zinc finger protein Krox-24 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P08046 |
| Length: | 85 |
| Pfam Domains: | 3-27 Zinc finger, C2H2 type 3-27 C2H2-type zinc finger 20-43 Zinc-finger double domain 33-55 Zinc finger, C2H2 type 33-55 C2H2-type zinc finger 47-71 Zinc-finger double domain 61-83 Zinc finger, C2H2 type 61-79 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP 60 61 FACDICGRKFARSDERKRHTKIHLR |
| Interface Residues: | 15, 16, 17, 18, 19, 21, 22, 41, 43, 44, 45, 46, 47, 49, 50, 51, 71, 72, 73, 74, 75, 76, 77, 78, 79 |
| 3D-footprint Homologues: | 7n5w_A, 6jnm_A, 1tf3_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 2kmk_A, 7ysf_A, 6ml4_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 8h9h_G, 5v3j_F, 6e94_A, 2lt7_A, 6a57_A, 2drp_D, 7y3l_A, 3uk3_C, 8cuc_F, 5yel_A, 2wbs_A, 7txc_E, 5k5i_A, 1llm_D, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D |
| Binding Motifs: | 1jk1_A cCGCCCaCGC 1jk2_A GCGtGGGC |
| Binding Sites: | 1jk1_C 1jk1_B 1jk2_B 1jk2_C |
| Publications: | Miller J.C, Pabo C.O. Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition. Journal of molecular biology 313:309-15 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.