Transcription Factor

						

			
Accessions: Aef1 (FlyZincFinger 1.0 )

			
Names: CG5683
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 116
Pfam Domains:      2-16 Zinc-finger double domain
     6-28 C2H2-type zinc finger
     6-26 Zinc-finger of C2H2 type
     6-28 Zinc finger, C2H2 type
     6-24 C2H2-type zinc finger
    21-44 Zinc-finger double domain
    33-52 C2H2-type zinc finger
    34-56 C2H2-type zinc finger
    34-54 Zinc-finger of C2H2 type
    34-56 C2H2-type zinc-finger domain
    34-56 Zinc finger, C2H2 type
    49-72 Zinc-finger double domain
    62-84 C2H2-type zinc finger
    62-84 Zinc finger, C2H2 type
   77-100 Zinc-finger double domain
   89-110 C2H2 type zinc-finger (2 copies)
   90-110 Zinc-finger of C2H2 type
   90-112 C2H2-type zinc finger
   90-112 Zinc finger, C2H2 type
   90-102 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 GSEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEK   60
  61 PYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDK
Interface Residues: 16, 17, 19, 20, 22, 23, 25, 26, 27, 29, 31, 34, 44, 45, 46, 47, 48, 50, 51, 55, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83, 100, 101, 102, 103, 104, 105, 106, 107, 108
3D-footprint Homologues: 6jnm_A, 7w1m_H, 8cuc_F, 5ei9_F, 1llm_D, 5k5i_A, 6ml4_A, 5v3j_F, 8ssq_A, 1f2i_J, 6blw_A, 5k5l_F, 1tf6_A, 6u9q_A, 8ssu_A, 1g2f_F, 5kkq_D, 7ysf_A, 2lt7_A, 6e94_A, 6a57_A, 2gli_A, 2jpa_A, 1ubd_C, 1yuj_A, 2kmk_A, 7n5w_A, 3uk3_C, 1tf3_A, 8gn3_A, 5kl3_A, 7txc_E, 2drp_D, 5yel_A, 4x9j_A, 8h9h_G, 7y3m_I, 7y3l_A, 2wbs_A, 4m9v_C, 5yj3_D
Binding Motifs: Aef1_FlyReg_FBgn0005694 CAACwACw
Aef1_SANGER_5_FBgn0005694 rCAACAACAMC
Aef1_SOLEXA_FBgn0005694 ggtTGTTGTTGTwrT
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.