Transcription Factor
| Accessions: | Aef1 (FlyZincFinger 1.0 ) |
| Names: | CG5683 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 116 |
| Pfam Domains: | 2-16 Zinc-finger double domain 6-28 C2H2-type zinc finger 6-26 Zinc-finger of C2H2 type 6-28 Zinc finger, C2H2 type 6-24 C2H2-type zinc finger 21-44 Zinc-finger double domain 33-52 C2H2-type zinc finger 34-56 C2H2-type zinc finger 34-54 Zinc-finger of C2H2 type 34-56 C2H2-type zinc-finger domain 34-56 Zinc finger, C2H2 type 49-72 Zinc-finger double domain 62-84 C2H2-type zinc finger 62-84 Zinc finger, C2H2 type 77-100 Zinc-finger double domain 89-110 C2H2 type zinc-finger (2 copies) 90-110 Zinc-finger of C2H2 type 90-112 C2H2-type zinc finger 90-112 Zinc finger, C2H2 type 90-102 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 GSEKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEK 60 61 PYNCNFCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDK |
| Interface Residues: | 16, 17, 19, 20, 22, 23, 25, 26, 27, 29, 31, 34, 44, 45, 46, 47, 48, 50, 51, 55, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83, 100, 101, 102, 103, 104, 105, 106, 107, 108 |
| 3D-footprint Homologues: | 6jnm_A, 7w1m_H, 8cuc_F, 5ei9_F, 1llm_D, 5k5i_A, 6ml4_A, 5v3j_F, 8ssq_A, 1f2i_J, 6blw_A, 5k5l_F, 1tf6_A, 6u9q_A, 8ssu_A, 1g2f_F, 5kkq_D, 7ysf_A, 2lt7_A, 6e94_A, 6a57_A, 2gli_A, 2jpa_A, 1ubd_C, 1yuj_A, 2kmk_A, 7n5w_A, 3uk3_C, 1tf3_A, 8gn3_A, 5kl3_A, 7txc_E, 2drp_D, 5yel_A, 4x9j_A, 8h9h_G, 7y3m_I, 7y3l_A, 2wbs_A, 4m9v_C, 5yj3_D |
| Binding Motifs: | Aef1_FlyReg_FBgn0005694 CAACwACw Aef1_SANGER_5_FBgn0005694 rCAACAACAMC Aef1_SOLEXA_FBgn0005694 ggtTGTTGTTGTwrT |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.