Transcription Factor
| Accessions: | YY2_full (HumanTF 1.0), YY2 (HT-SELEX2 May2017), O15391 (JASPAR 2024) |
| Names: | Transcription factor YY2, TYY2_HUMAN, Yin and yang 2, YY-2, YY2, Zinc finger protein 631, ENSG00000230797 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2, JASPAR 2024 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | O15391 |
| Notes: | Ensembl ID: ENSG00000198767; Full protein sequence; TF family: znfC2H2; Clone source: hORFeome, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 372 |
| Pfam Domains: | 255-278 C2H2-type zinc finger 283-305 C2H2-type zinc finger 283-305 Zinc finger, C2H2 type 298-323 Zinc-finger double domain 311-335 C2H2-type zinc finger 311-335 Zinc finger, C2H2 type 327-353 Zinc-finger double domain 341-365 C2H2-type zinc finger 341-365 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MASNEDFSITQDLEIPADIVELHDINVEPLPMEDIPTESVQYEDVDGNWIYGGHNHPPLM 60 61 VLQPLFTNTGYGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTL 120 121 ASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTLE 180 181 GEFSVTMWSPNDNNDQGAVGEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTK 240 241 VKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR 300 301 HQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTNLKT 360 361 HILTHVKTKNNP |
| Interface Residues: | 266, 267, 268, 269, 270, 272, 273, 274, 275, 276, 293, 294, 295, 296, 297, 298, 299, 300, 301, 323, 324, 325, 326, 327, 329, 330, 353, 354, 355, 356, 357, 358, 359, 360, 364 |
| 3D-footprint Homologues: | 7w1m_H, 5ei9_F, 6ml4_A, 5v3j_F, 4m9v_C, 7ysf_A, 2jpa_A, 1ubd_C, 6jnm_A, 1tf3_A, 7y3l_A, 7n5w_A, 5kl3_A, 7txc_E, 1tf6_A, 8ssq_A, 6blw_A, 2kmk_A, 1g2f_F, 8ssu_A, 5kkq_D, 8gn3_A, 4x9j_A, 2gli_A, 8h9h_G, 6e94_A, 2lt7_A, 6a57_A, 3uk3_C, 8cuc_F, 2wbs_A, 1f2i_J, 5k5i_A, 6u9q_A, 5yel_A, 1llm_D, 5yj3_D, 7y3m_I |
| Binding Motifs: | MA0748.1 gwcCGCCATtw YY2_full aCCGCCATyty YY2_2 kkCCGCCATTTTGw YY2_methyl_1 gkCsGCCATTTTGr MA0748.2 msATGGCGGcs MA0748.3 ATGGCGG |
| Binding Sites: | MA0748.3.14 / MA0748.3.3 MA0748.2.1 MA0748.2.10 / MA0748.2.5 MA0748.2.11 MA0748.2.12 MA0748.2.13 / MA0748.2.6 MA0748.2.14 MA0748.2.15 MA0748.2.16 MA0748.2.17 / MA0748.2.8 MA0748.2.18 MA0748.2.19 / MA0748.2.9 MA0748.2.1 / MA0748.2.2 MA0748.2.20 MA0748.2.2 / MA0748.2.3 MA0748.2.4 MA0748.2.5 / MA0748.2.6 / MA0748.2.7 MA0748.2.3 / MA0748.2.8 MA0748.2.4 / MA0748.2.9 MA0748.2.10 MA0748.2.11 MA0748.2.12 MA0748.2.13 MA0748.2.14 MA0748.2.15 MA0748.2.16 MA0748.2.17 MA0748.2.18 MA0748.2.19 MA0748.2.20 MA0748.2.7 MA0748.3.1 MA0748.3.10 / MA0748.3.16 / MA0748.3.17 / MA0748.3.18 / MA0748.3.19 / MA0748.3.4 / MA0748.3.5 / MA0748.3.9 MA0748.3.11 / MA0748.3.15 / MA0748.3.2 / MA0748.3.20 MA0748.3.12 / MA0748.3.13 MA0748.3.6 MA0748.3.7 MA0748.3.8 |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Kim J. D., Faulk C., Kim J. Retroposition and evolution of the DNA-binding motifs of YY1, YY2 and REX1.. Nucleic Acids Res. 35:3442-3452 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.