Transcription Factor

Accessions: 2ld5_A (3D-footprint 20241219)
Names: Homeobox protein Hox-1.10, Homeobox protein Hox-A13, HXA13_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q62424
Length: 67
Pfam Domains: 2-58 Homeobox domain
Sequence:
(in bold interface residues)
1 GRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVI 60
61 NKLKTTS
Interface Residues: 2, 3, 4, 5, 43, 44, 46, 47, 50, 51, 53, 54, 55, 58
3D-footprint Homologues: 8ejp_B, 8pmf_A, 1zq3_P, 2lkx_A, 2ld5_A, 7q3o_C, 6es3_K, 8osb_E, 6m3d_C, 7psx_B, 2hdd_A, 8eml_B, 4cyc_A, 9b8u_A, 2hos_A, 8ik5_C, 7xrc_C
Binding Motifs: 2ld5_A AAATAAaAT
Binding Sites: 2ld5_B
2ld5_C
Publications: Zhang Y, Larsen C.A, Stadler H.S, Ames J.B. Structural basis for sequence specific DNA binding and protein dimerization of HOXA13. PloS one 6:e23069 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.