Transcription Factor
Accessions: | 2ld5_A (3D-footprint 20231221) |
Names: | Homeobox protein Hox-1.10, Homeobox protein Hox-A13, HXA13_MOUSE |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q62424 |
Length: | 67 |
Pfam Domains: | 2-58 Homeobox domain |
Sequence: (in bold interface residues) | 1 GRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVI 60 61 NKLKTTS |
Interface Residues: | 2, 3, 4, 5, 43, 44, 46, 47, 50, 51, 54, 55, 58 |
3D-footprint Homologues: | 1puf_A, 1ig7_A, 3cmy_A, 3d1n_M, 6a8r_A, 1fjl_B, 2h1k_B, 5zfz_A, 2lkx_A, 1nk2_P, 1zq3_P, 7q3o_C, 2ld5_A, 6es3_K, 6m3d_C, 5flv_I, 2hdd_A, 5zjt_E, 4cyc_A, 2r5y_A, 1jgg_B, 7psx_B, 5hod_A, 2hos_A, 5jlw_D, 3lnq_A, 4xrs_G, 3a01_E, 1b72_A, 3rkq_B, 1e3o_C, 2xsd_C, 1au7_A, 1le8_A, 7xrc_C, 1mnm_C, 1du0_A, 1puf_B, 4qtr_D, 1k61_B, 1o4x_A |
Binding Motifs: | 2ld5_A AAATAAaAT |
Binding Sites: | 2ld5_B 2ld5_C |
Publications: | Zhang Y, Larsen C.A, Stadler H.S, Ames J.B. Structural basis for sequence specific DNA binding and protein dimerization of HOXA13. PloS one 6:e23069 (2011). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.