Transcription Factor

Accessions: 2d5v_B (3D-footprint 20231221)
Names: Hepatocyte nuclear factor 6, HNF-6, HNF6_RAT, One cut domain family member 1, One cut homeobox 1
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: A4II00
Length: 135
Pfam Domains: 2-77 CUT domain
80-131 Homeobox domain
Sequence:
(in bold interface residues)
1 MEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFR 60
61 RMWKWLQEPEFQRMSALRLPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELST 120
121 VSNFFMNARRRSLDK
Interface Residues: 28, 29, 30, 33, 34, 35, 36, 37, 38, 40, 41, 44, 48, 58, 61, 73, 81, 122, 123, 126, 127, 130, 131
3D-footprint Homologues: 1au7_A, 2o4a_A, 2d5v_B, 6y93_B, 1e3o_C, 2hos_A, 5hod_A, 4qtr_D, 6fqq_E, 4xrm_B, 1o4x_A, 1puf_B, 8g87_X, 3l1p_A, 6fqp_B
Binding Motifs: 2d5v_B TgGTCAaTA
Binding Sites: 2d5v_E
2d5v_F
Publications: Iyaguchi D, Yao M, Watanabe N, Nishihira J, Tanaka I. DNA recognition mechanism of the ONECUT homeodomain of transcription factor HNF-6. Structure (London, England : 1993) 15:75-83 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.