Transcription Factor

Accessions: RXRA_DBD (HumanTF 1.0), RXRA (HT-SELEX2 May2017)
Names: Fragment, Q6P3U7_HUMAN, RXRA, RXRA protein, ENSG00000186350
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q6P3U7
Notes: Ensembl ID: ENSG00000186350; DNA-binding domain sequence; TF family: Nuclear_Receptor; Clone source: Gene synthesis, TF family: Nuclear_receptor experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Nuclear_receptor experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 111
Pfam Domains: 21-89 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 NGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRD 60
61 NKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTS
Interface Residues: 30, 31, 33, 34, 40, 41, 43, 44, 47, 48, 72, 94, 96, 98, 101
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B
Binding Motifs: RXRA_DBD_1 grGGTCAAAGGTCA
RXRA_DBD_2 rrGGTCATGACCyy
RXRA_2 grGGTCAAAGGTCAy
RXRA_methyl_1 rrGGTCAAAGGTCAh
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.