Transcription Factor
| Accessions: | CDX1_HUMAN (HOCOMOCO 10), P47902 (JASPAR 2024) |
| Names: | Caudal-type homeobox protein 1, CDX1_HUMAN, Homeobox protein CDX-1 |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P47902 |
| Length: | 265 |
| Pfam Domains: | 13-146 Caudal like protein activation region 156-211 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTA 60 61 WGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPG 120 121 TPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYIT 180 181 IRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSL 240 241 GGLCPSNTSLLATSSPMPVKEEFLP |
| Interface Residues: | 155, 156, 157, 158, 196, 197, 199, 200, 203, 204, 206, 207, 208, 211 |
| 3D-footprint Homologues: | 8pmf_A, 1puf_A, 2lkx_A, 1jgg_B, 3lnq_A, 1nk2_P, 1zq3_P, 6es3_K, 2ld5_A, 7q3o_C, 8eml_B, 1ig7_A, 4xrs_G, 3cmy_A, 2hdd_A, 5zfz_A, 4cyc_A, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 9b8u_A, 5zjt_E, 8ik5_C, 7psx_B, 8ejp_B, 1fjl_B, 6a8r_A, 3a01_E, 8osb_E, 5jlw_D, 3rkq_B, 7xrc_C, 1e3o_C, 2xsd_C, 1au7_A, 1le8_A, 1o4x_A, 1le8_B, 1du0_A, 8g87_X, 3d1n_M, 1mnm_C, 8bx1_A, 4qtr_D, 1puf_B, 1k61_B, 5hod_A, 4xrm_B, 1b72_A |
| Binding Motifs: | MA0878.1 gymATAAAa MA0878.2 gGYmATAAAac CDX1_HUMAN.H10MO.C|M01046 aTTTAtGk MA0878.3 GGymATAAAA |
| Publications: | Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.