Transcription Factor

Accessions: 1yrn_A (3D-footprint 20241219)
Names: MAT A1 HOMEODOMAIN, MATa1 protein, MATA1_YEASX, Mating-type protein A1
Organisms: Saccharomyces cerevisiae
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CY10
Length: 49
Pfam Domains: 2-48 Homeobox domain
22-48 Homeobox KN domain
Sequence:
(in bold interface residues)
1 ISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS
Interface Residues: 36, 39, 40, 43, 44, 46, 47, 48
3D-footprint Homologues: 8ik5_C, 8osb_E, 7q3o_C, 7xrc_C, 7psx_B, 1zq3_P, 9b8u_A, 8ejp_B, 2lkx_A, 8eml_B, 4cyc_A, 2hdd_A, 8g87_X, 6es3_K, 8pmf_A, 8bx1_A, 2hos_A, 2h8r_B, 8pi8_B
Binding Motifs: 1yrn_AB TGTAawTnnTtnCnTCA
Publications: Li T, Stark M.R, Johnson A.D, Wolberger C. Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA. Science (New York, N.Y.) 270:262-9 (1995). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.