Transcription Factor
| Accessions: | 2dgc_A (3D-footprint 20250804) |
| Names: | Amino acid biosynthesis regulatory protein, GCN4_YEAST, General control protein GCN4 |
| Organisms: | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P03069 |
| Length: | 49 |
| Pfam Domains: | 2-48 bZIP transcription factor 3-48 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 ALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKL |
| Interface Residues: | 4, 6, 7, 8, 9, 10, 11, 14, 15 |
| 3D-footprint Homologues: | 6mg1_B, 8k86_A, 8k8c_A, 1llm_D, 2dgc_A, 5t01_B, 5vpe_D |
| Binding Motifs: | 2dgc_A CGTCa |
| Binding Sites: | 2dgc_B |
| Publications: | Keller W, König P, Richmond T.J. Crystal structure of a bZIP/DNA complex at 2.2 A: determinants of DNA specific recognition. Journal of molecular biology 254:657-67 (1995). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.