Transcription Factor

						

			
Accessions: NFE2_DBD (HumanTF 1.0)

			
Names: Leucine zipper protein NF-E2, NFE2, NFE2_HUMAN, Nuclear factor, erythroid-derived 2 45 kDa subunit, p45 NF-E2, Transcription factor NF-E2 45 kDa subunit
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q16621
Notes: Ensembl ID: ENSG00000123405; DNA-binding domain sequence; TF family: bZIP; Clone source: MGC
Length: 150
Pfam Domains:    39-129 bZIP Maf transcription factor
   69-111 bZIP transcription factor
   71-109 Basic region leucine zipper
Sequence: 
(in bold interface residues)		   1 MALALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLT   60
  61 ESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLE  120
 121 VMRQQLTELYRDIFQHLRDESGNSYSPEEY
Interface Residues: 72, 76, 77, 79, 80, 83, 84, 87
3D-footprint Homologues: 7x5e_E, 4eot_A, 7x5e_F, 1skn_P, 2wt7_A, 2wt7_B, 5t01_B, 5vpe_D
Binding Motifs: NFE2_DBD vATGACTCATs
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.