Transcription Factor

						

			
Accessions: 5yel_A (3D-footprint 20231221)

			
Names: 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P49711
Length: 166
Pfam Domains:      1-14 C2H2-type zinc finger
     2-25 C2H2-type zinc finger
    29-53 C2H2-type zinc finger
    29-52 Zinc finger, C2H2 type
    29-52 C2H2-type zinc finger
    60-81 C2H2-type zinc finger
    60-82 C2H2-type zinc finger
    60-81 Zinc finger, C2H2 type
    74-95 Zinc-finger double domain
  104-124 Zinc-finger double domain
  114-137 Zinc finger, C2H2 type
  114-137 C2H2-type zinc finger
  114-124 C2H2-type zinc finger
  116-160 LIM domain
  129-155 Zinc-finger double domain
  144-165 Zinc finger, C2H2 type
  144-165 C2H2-type zinc finger
  144-155 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 PYECYICHARFTQSGTMKMHILQKHVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKK   60
  61 CRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYASRQERHMIMHKRTHTGKPYACSHCD  120
 121 KTFRQKQLLDMHFKRYHDPVPAAFVCSKCGKTFTRRNTMARHADNC
Interface Residues: 13, 14, 15, 16, 18, 19, 29, 40, 41, 42, 43, 46, 49, 51, 69, 70, 71, 72, 73, 75, 76, 78, 79, 82, 96, 97, 98, 99, 100, 101, 103, 104, 105, 108, 124, 125, 126, 127, 128, 129, 130, 131, 132, 135, 154, 155, 156, 157, 158, 161
3D-footprint Homologues: 2drp_D, 5k5i_A, 8ssq_A, 7w1m_H, 5und_A, 8ssu_A, 5v3j_F, 2i13_A, 5kkq_D, 1yuj_A, 6e94_A, 5yel_A, 2kmk_A, 5k5l_F, 6blw_A, 7ysf_A, 1ubd_C, 3uk3_C, 6jnm_A, 7n5w_A, 1tf3_A, 6wmi_A, 6ml4_A, 4x9j_A, 1f2i_J, 6u9q_A, 5ei9_F, 7eyi_G, 8h9h_G, 1tf6_A, 6a57_A, 2lt7_A, 2jpa_A, 8cuc_F, 7y3l_A, 1g2f_F, 8gn3_A, 1mey_C, 2wbs_A, 7txc_E, 4m9v_C, 7y3m_I, 5kl3_A, 2gli_A, 1llm_D, 5yj3_D
Binding Motifs: 5yel_A ACTGgnnnnnnnnGGTACnGCA
Binding Sites: 5yel_E
5yel_F
			
Publications: Yin M, Wang J, Wang M, Li X, Zhang M, Wu Q, Wang Y. Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites. Cell Res 27:1365-1377 (2017). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.