Transcription Factor

Accessions: her (FlyZincFinger 1.0 )
Names: CG4694
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 136
Pfam Domains: 2-26 C2H2-type zinc finger
2-26 C2H2-type zinc-finger domain
2-26 Zinc finger, C2H2 type
37-59 C2H2-type zinc-finger domain
78-101 Zinc finger, C2H2 type
79-102 C2H2-type zinc finger
111-134 Zinc finger, C2H2 type
111-129 C2H2-type zinc finger
111-134 C2H2-type zinc-finger domain
Sequence:
(in bold interface residues)
1 KFRCSVDRCPYRTNRPYNLARHEESHIGITQSKLYGCPVCVYNTDKASNLKRHVSIKHPG 60
61 CKKRPPEAQHKDRNAKLQCLVMGCRYETNRPYDLKRHLMVHNNPEKSHRTFKCSLCTYSS 120
121 DRKANLKRHHELRHSG
Interface Residues: 14, 15, 17, 18, 21, 35, 45, 46, 47, 48, 49, 51, 52, 81, 82, 89, 90, 92, 93, 94, 96, 97, 100, 122, 123, 124, 125, 127, 128
3D-footprint Homologues: 7ysf_A, 1g2f_F, 6blw_A, 1llm_D, 7w1m_H, 5kl3_A, 2jpa_A, 4x9j_A, 1ubd_C, 5v3j_F, 1f2i_J, 5k5i_A, 8h9h_G, 7n5w_A, 2kmk_A, 7txc_E, 5kkq_D, 2drp_D, 8ssq_A, 8ssu_A, 1yuj_A, 2wbs_A, 8gn3_A, 7y3l_A, 7y3m_I, 3uk3_C, 8cuc_F, 6u9q_A, 5yj3_D
Binding Motifs: her_SANGER_10_FBgn0001185 rCGsawwwrTGAGya
her_SOLEXA_10_FBgn0001185 rCGCAwwwrTGAGya
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.