Transcription Factor
| Accessions: | her (FlyZincFinger 1.0 ) |
| Names: | CG4694 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 136 |
| Pfam Domains: | 2-26 C2H2-type zinc finger 2-26 C2H2-type zinc-finger domain 2-26 Zinc finger, C2H2 type 37-59 C2H2-type zinc-finger domain 78-101 Zinc finger, C2H2 type 79-102 C2H2-type zinc finger 111-134 Zinc finger, C2H2 type 111-129 C2H2-type zinc finger 111-134 C2H2-type zinc-finger domain |
| Sequence: (in bold interface residues) | 1 KFRCSVDRCPYRTNRPYNLARHEESHIGITQSKLYGCPVCVYNTDKASNLKRHVSIKHPG 60 61 CKKRPPEAQHKDRNAKLQCLVMGCRYETNRPYDLKRHLMVHNNPEKSHRTFKCSLCTYSS 120 121 DRKANLKRHHELRHSG |
| Interface Residues: | 14, 15, 17, 18, 21, 35, 45, 46, 47, 48, 49, 51, 52, 81, 82, 89, 90, 92, 93, 94, 96, 97, 100, 122, 123, 124, 125, 127, 128 |
| 3D-footprint Homologues: | 7ysf_A, 1g2f_F, 6blw_A, 1llm_D, 7w1m_H, 5kl3_A, 2jpa_A, 4x9j_A, 1ubd_C, 5v3j_F, 1f2i_J, 5k5i_A, 8h9h_G, 7n5w_A, 2kmk_A, 7txc_E, 5kkq_D, 2drp_D, 8ssq_A, 8ssu_A, 1yuj_A, 2wbs_A, 8gn3_A, 7y3l_A, 7y3m_I, 3uk3_C, 8cuc_F, 6u9q_A, 5yj3_D |
| Binding Motifs: | her_SANGER_10_FBgn0001185 rCGsawwwrTGAGya her_SOLEXA_10_FBgn0001185 rCGCAwwwrTGAGya |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.