Transcription Factor

Accessions: 5x5l_H (3D-footprint 20250804)
Names: AdeR, E1A0Z5_ACIBA
Organisms: Acinetobacter baumannii
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: E1A0Z5
Length: 95
Pfam Domains: 23-92 Transcriptional regulatory protein, C terminal
Sequence:
(in bold interface residues)
1 NKLYKNIEIDTDTHSVYIHSILLNLTLTEYKIISFMIDQPHKVFTRGELMNHCMSDALER 60
61 TVDSHVSKLRKKLEEQGIFQMLINVRGVGYRLDNP
Interface Residues: 59, 60, 61, 63, 64, 65, 67, 68, 86
3D-footprint Homologues: 8jo2_H, 6lxn_A, 8hml_B, 4nhj_A, 7e1b_B, 5ed4_A, 8hig_A, 5x5l_H, 8hih_Q, 2z33_A
Binding Motifs: 5x5l_BH CAnnnntnnncCAcA
5x5l_H CCACACnTT
Binding Sites: 5x5l_C
5x5l_D
Publications: Wen Y, Ouyang Z, Yu Y, Zhou X, Pei Y, Devreese B, Higgins PG, Zheng F. Mechanistic insight into how multidrug resistant Acinetobacter baumannii response regulator AdeR recognizes an intercistronic region. Nucleic Acids Res 45:9773-9787 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.