Transcription Factor

						

			
Accessions: 1r8d_A (3D-footprint 20231221)

			
Names: HTH-type transcriptional activator mta, MTA_BACSU, Multidrug transporter activation protein, transcription activator MtaN
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P71039
Length: 109
Pfam Domains:      3-71 MerR HTH family regulatory protein
     5-41 MerR family regulatory protein
   46-104 MerR, DNA binding
Sequence: 
(in bold interface residues)		   1 MKYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQQILFFKEIGF   60
  61 RLDEIKEMLDHPNFDRKAALQSQKEILMKKKQRMDEMIQTIDRTLLSVD
Interface Residues: 17, 20, 21, 24, 25, 38, 39
3D-footprint Homologues: 7tea_B, 5c8e_C, 6xh7_H, 2zhg_A, 5d8c_A, 1r8d_B, 6xl5_H, 4r24_B, 6jgx_B, 1r8e_A, 7ckq_G, 4r4e_B, 6ldi_G, 2vz4_A
Binding Motifs: 1r8d_AB CnnnnACGTnGCGTnannG
			
Publications: Newberry K.J, Brennan R.G. The structural mechanism for transcription activation by MerR family member multidrug transporter activation, N terminus. The Journal of biological chemistry 279:20356-62 (2004). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.