Transcription Factor

Accessions: 5edn_G (3D-footprint 20250804)
Names: Homeobox protein Hox-B13, HXB13_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q92826
Length: 60
Pfam Domains: 1-56 Homeobox domain
Sequence:
(in bold interface residues)
1 KKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAK 60
Interface Residues: 1, 2, 3, 11, 27, 29, 41, 42, 44, 45, 48, 49, 51, 52, 53, 56
3D-footprint Homologues: 1nk2_P, 1zq3_P, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 3cmy_A, 2hdd_A, 8pmf_A, 7psx_B, 6a8r_A, 2r5y_A, 1puf_A, 8eml_B, 1jgg_B, 6m3d_C, 5jlw_D, 3lnq_A, 2hos_A, 4xrs_G, 1au7_A, 5zfz_A, 3rkq_B, 9b8u_A, 1fjl_B, 5flv_I, 3a01_E, 8osb_E, 1b72_A, 5zjt_E, 4cyc_A, 8ejp_B, 1ig7_A, 8upo_A, 6vu3_A, 6vz3_A, 8ik5_C, 1e3o_C, 2xsd_C, 7xrc_C, 1le8_A, 1le8_B, 1du0_A, 4qtr_D, 1mnm_C, 1puf_B, 1k61_B, 6fqp_B, 1o4x_A, 6fqq_E, 5hod_A
Binding Motifs: 5edn_BG gnnnnnGTAAAnnnnnGnnnnnntnaCTAG
Binding Sites: 5edn_D
5edn_E
Publications: Morgunova E, Yin Y, Das PK, Jolma A, Zhu F, Popov A, Xu Y, Nilsson L, Taipale J. Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima. Elife : (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.