Transcription Factor

Accessions: T057645_1.02 (CISBP 1.02)
Names: pag-3, T057645_1.02;
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 336
Pfam Domains: 126-148 C2H2-type zinc finger
126-148 Zinc finger, C2H2 type
126-148 C2H2-type zinc finger
140-165 Zinc-finger double domain
154-172 C2H2-type zinc finger
154-176 Zinc finger, C2H2 type
154-176 C2H2-type zinc finger
169-192 Zinc-finger double domain
182-191 C2H2-type zinc finger
182-204 Zinc finger, C2H2 type
182-200 C2H2-type zinc finger
197-220 Zinc-finger double domain
209-232 C2H2-type zinc finger
210-232 Zinc finger, C2H2 type
210-232 C2H2-type zinc finger
224-247 Zinc-finger double domain
238-261 C2H2-type zinc finger
238-248 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MSTEHVSNVYSVESLLSNVEKSSVSPTESIEDRNEFMITEDVMSSWQRMAATISLQQKLL 60
61 MMQQTMPRPPPVNILGNFPFGFLNAPMFWQQYLRSMAMGIIPQNPESPSASVWNRTPTPP 120
121 VEIKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTR 180
181 PYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFAC 240
241 DVCGRTFQRKVDRRRHRESHHPGHPEECVSASQISSDLSPKGYMTPPTSNGYLDSSDEFL 300
301 NVFRLPAELLAIKAEMGEEMEEADDEEEKVLNLSVS
Interface Residues: 136, 137, 138, 139, 140, 143, 147, 154, 164, 165, 166, 167, 168, 170, 171, 172, 173, 174, 175, 177, 192, 193, 194, 195, 196, 197, 198, 199, 200, 202, 220, 221, 222, 223, 224, 226, 227, 248, 249, 250, 251, 252, 255, 259
3D-footprint Homologues: 5v3j_F, 6jnm_A, 8ssu_A, 5kkq_D, 5ei9_F, 6wmi_A, 5k5i_A, 7w1m_H, 5und_A, 1tf6_A, 2i13_A, 7ysf_A, 8ssq_A, 5yel_A, 2kmk_A, 6ml4_A, 8gn3_A, 2drp_D, 7eyi_G, 4m9v_C, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 1ubd_C, 7n5w_A, 3uk3_C, 1tf3_A, 1g2f_F, 5k5l_F, 4x9j_A, 6blw_A, 2wbs_A, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 2gli_A, 8h9h_G, 7y3l_A, 8cuc_F, 1llm_D, 7y3m_I, 5yj3_D
Binding Motifs: M0451_1.02 chswGATTtw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.