Transcription Factor
| Accessions: | RFX3_TF1 (HumanTF2 1.0), RFX3 (HT-SELEX2 May2017) |
| Names: | Regulatory factor X 3, RFX3, RFX3_HUMAN, Transcription factor RFX3, ENSG00000080298 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P48380 |
| Notes: | Ensembl ID: ENSG00000080298; Construct type: TF1(SBP); TF family: RFX; Clone source: Jolma et al. 2013, TF family: RFX experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: RFX experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 157 |
| Pfam Domains: | 61-127 RFX DNA-binding domain |
| Sequence: (in bold interface residues) | 1 VTGGQLISSSGGTYLIGNSMENSGHSVTHTTRASPATIEMAIETLQKSDGLSTHRSSLLN 60 61 SHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRRL 120 121 GTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQP |
| Interface Residues: | 102, 106, 119, 123, 128 |
| 3D-footprint Homologues: | 1dp7_P |
| Binding Motifs: | RFX3_BHLHA15 TrGCaACgavCATATGkt RFX3_ETV7 ascmGGAAgyryTTCCyTrgCaACs RFX3_FIGLA_1 GTTgCyatGgcracgsmmCAssTG RFX3_FIGLA_2 wrGcAACgsmmCAssTGka RFX3_HES7 TrGCAACssrCACGyGcs RFX3_SREBF2 mTrGyAACrTCACGTGAy RFX3_SRF trGcAACswykaCCwwatawGGt RFX3_3 sGTTryYATRryAACs RFX3_4 sGTTGCyTAGCAACs RFX3_methyl_1 sGTTryYATRryAACs RFX3_methyl_2 sGTTGCyTAGCAACs |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.