Transcription Factor
| Accessions: | JUN (HT-SELEX2 May2017), JUN_HUMAN (HOCOMOCO 10), P05412 (JASPAR 2024) |
| Names: | ENSG00000177606, JUN, Activator protein 1, AP1, JUN_HUMAN, p39, Proto-oncogene c-Jun, Transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homolog, Transcription factor AP-1 subunit Jun, Transcription factor Jun |
| Organisms: | Homo sapiens, Rattus norvegicus |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3b0, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3b0 |
| Length: | 331 |
| Pfam Domains: | 5-241 Jun-like transcription factor 250-313 bZIP transcription factor 255-310 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL 60 61 LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE 120 121 LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA 180 181 LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP 240 241 PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM 300 301 LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
| Interface Residues: | 258, 259, 261, 262, 263, 265, 266, 269, 270, 273 |
| 3D-footprint Homologues: | 2wt7_B, 1skn_P, 4eot_A, 7x5e_F, 2wt7_A, 1gd2_G, 8k8c_A, 5vpe_D, 2dgc_A, 5t01_B, 1dh3_C, 5vpe_C |
| Binding Motifs: | MA0099.2 TGAmTCA MA0462.1 rrwATGAsTCA MA0488.1 awrATGAtGTmAT MA0489.1 rrrrrrTGAsTCAt JUN_3 gATGACGTCAyc JUN_4 gaTGACkCAtm JUN_methyl_1 kATGAsTCATm JUN_methyl_2 kATGACTCATm JUN_HUMAN.H10MO.A|M01283 mTGAGTCAy MA0099.3 rTGAGTCAym MA1126.1 drTgACGTCAtmmkty MA1127.1 gaTGACGTCAy MA1128.1 kkrTGACTCAtmm MA1129.1 rTgACGTcAy MA1130.1 kkrTGAGTCAym MA1131.1 grTGACGTmAt MA0462.2 waTGACTCAth MA0099.4 rTGAGTCAy MA0488.2 ATGAtGTmAT MA1126.2 rTgACGTCAt |
| Binding Sites: | MA0099.2.1 MA0099.2.10 MA0099.2.11 MA0099.2.12 MA0099.2.13 MA0099.2.14 MA0099.2.15 MA0099.2.16 MA0099.2.17 MA0099.2.18 MA0099.2.2 MA0099.2.3 / MA0099.2.4 MA0099.2.5 MA0099.2.6 / MA0099.2.7 MA0099.2.8 MA0099.2.9 MA0462.1.1 MA0462.1.10 MA0462.1.11 MA0462.1.12 MA0462.1.13 MA0462.1.14 MA0462.1.15 MA0462.1.16 MA0462.1.17 MA0462.1.18 / MA0462.1.19 MA0462.1.2 MA0462.1.20 MA0462.1.3 MA0462.1.4 MA0462.1.5 MA0462.1.6 MA0462.1.7 MA0462.1.8 MA0462.1.9 MA0488.1.1 MA0488.1.10 MA0488.1.11 MA0488.1.12 MA0488.1.13 MA0488.1.14 MA0488.1.15 MA0488.1.16 MA0488.1.17 MA0488.1.18 MA0488.1.19 MA0488.1.2 MA0488.1.20 MA0488.1.3 MA0488.1.4 MA0488.1.5 MA0488.1.6 MA0488.1.7 MA0488.1.8 MA0488.1.9 MA0489.1.1 MA0489.1.10 / MA0489.1.13 / MA0489.1.17 / MA0489.1.18 MA0489.1.11 MA0489.1.12 MA0489.1.14 MA0489.1.15 MA0489.1.16 MA0489.1.19 MA0489.1.2 MA0489.1.20 MA0489.1.3 MA0489.1.4 MA0489.1.5 MA0489.1.6 MA0489.1.7 MA0489.1.8 MA0489.1.9 MA0462.2.1 MA0462.2.10 / MA0462.2.5 MA0462.2.11 / MA0462.2.6 MA0462.2.12 MA0462.2.13 MA0462.2.14 MA0462.2.15 / MA0462.2.7 MA0462.2.16 MA0462.2.17 / MA0462.2.8 MA0462.2.18 MA0462.2.19 / MA0462.2.9 MA0462.2.1 / MA0462.2.2 MA0462.2.10 / MA0462.2.20 MA0462.2.2 / MA0462.2.3 MA0462.2.4 MA0462.2.3 / MA0462.2.5 MA0462.2.6 MA0462.2.4 / MA0462.2.7 MA0462.2.8 MA0462.2.9 MA0462.2.11 MA0462.2.12 MA0462.2.13 MA0462.2.14 MA0462.2.15 MA0462.2.16 MA0462.2.17 MA0462.2.18 MA0462.2.19 MA0462.2.20 MA0488.2.1 MA0488.2.10 MA0488.2.11 MA0488.2.12 MA0488.2.13 MA0488.2.14 MA0488.2.15 MA0488.2.16 MA0488.2.17 MA0488.2.18 MA0488.2.19 MA0488.2.2 MA0488.2.20 MA0488.2.3 MA0488.2.4 MA0488.2.5 MA0488.2.6 MA0488.2.7 MA0488.2.8 MA0488.2.9 |
| Publications: | Portales-Casamar E, Kirov S, Lim J, Lithwick S, Swanson M.I, Ticoll A, Snoddy J, Wasserman W.W. PAZAR: a framework for collection and dissemination of cis-regulatory sequence annotation. Genome biology 8:R207 (2007). [Pubmed] Li M, Ge Q, Wang W, Wang J, Lu Z. c-Jun binding site identification in K562 cells. Journal of genetics and genomics = Yi chuan xue bao 38:235-42 (2011). [Pubmed] Li P, Spolski R, Liao W, Wang L, Murphy TL, Murphy KM, Leonard WJ. BATF-JUN is critical for IRF4-mediated transcription in T cells. Nature 490:543-6 (2012). [Pubmed] Shaulian E, Karin M. AP-1 as a regulator of cell life and death. Nat Cell Biol : (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.