Transcription Factor

Accessions: T061519_1.02 (CISBP 1.02)
Names: T061519_1.02;, Y53H1A.2
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 214
Pfam Domains: 143-165 C2H2-type zinc finger
171-192 Zinc finger, C2H2 type
171-192 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MATMTERKQDFSCPNYMLFGDDFNLQSGIEDISCSSNYTSDEDGPKVLTTMRNMFAEQKT 60
61 DEYELVYDNNSQNVPQNCSPKNQYSPPQSVQQAHYSNLSHFHPRNPEFSQEIVENRVISP 120
121 KSEHPEEIEDHEDDEDGQSEMKHNCPECPKKYTSERRLKHHIVVHRNPDAYKCQKCGYCY 180
181 QSPDSLRRHWKKTPNCDEFPPKINVKTEILDPDS
Interface Residues: 119, 121, 123, 126, 127, 130, 153, 154, 155, 156, 157, 159, 160, 161, 163, 182, 183, 184, 185, 186, 187, 188, 189, 192, 206, 207, 208
3D-footprint Homologues: 7n5w_A, 7eyi_G, 8h9h_G, 4x9j_A, 1mey_C, 8ssu_A, 7y3l_A, 3uk3_C, 1g2f_F, 5kkq_D, 7ysf_A, 6ml4_A, 8ssq_A, 7w1m_H, 5v3j_F, 2kmk_A, 8cuc_F, 1f2i_J, 8gn3_A, 5ei9_F, 1ubd_C, 2i13_A, 1llm_D, 6wmi_A, 4m9v_C, 7y3m_I, 6e94_A, 5yj3_D, 2wbs_A
Binding Motifs: M0496_1.02 ykGyskkcrb
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.