Transcription Factor

						

			
Accessions: 1hwt_H (3D-footprint 20231221)

			
Names: CYP1 activatory protein, HAP1_YEASX, HEME ACTIVATOR PROTEIN, Heme activator protein 1, Heme-responsive zinc finger transcription factor HAP1
Organisms: Saccharomyces cerevisiae
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CS82
Length: 73
Pfam Domains:      8-42 Fungal Zn(2)-Cys(6) binuclear cluster domain
Sequence: 
(in bold interface residues)		   1 KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELK   60
  61 KLRERVKSLEKTL
Interface Residues: 15, 16, 17, 18, 20, 21
3D-footprint Homologues: 1hwt_C, 1pyi_A, 6o19_A, 3coq_A, 7uik_T, 6gys_C, 1zme_D, 1d66_B, 8h9h_G, 7n5w_A
Binding Motifs: 1hwt_GH GCGATAatnGCG
Binding Sites: 1hwt_E
1hwt_F
			
Publications: King D.A, Zhang L, Guarente L, Marmorstein R. Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein. Nature structural biology 6:64-71 (1999). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.