Transcription Factor
| Accessions: | 1hwt_H (3D-footprint 20260701) |
| Names: | CYP1 activatory protein, HAP1_YEASX, HEME ACTIVATOR PROTEIN, Heme activator protein 1, Heme-responsive zinc finger transcription factor HAP1 |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0CS82 |
| Length: | 73 |
| Pfam Domains: | 8-42 Fungal Zn(2)-Cys(6) binuclear cluster domain |
| Sequence: (in bold interface residues) | 1 KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELK 60 61 KLRERVKSLEKTL |
| Interface Residues: | 2, 4, 8, 15, 16, 17, 18, 20, 21 |
| 3D-footprint Homologues: | 2hap_D, 1pyi_A, 6o19_A, 6gys_C, 1zme_D, 1d66_B, 3coq_A, 7uik_T, 8h9h_G, 7n5w_A |
| Binding Motifs: | 1hwt_GH GCGATAatnGCG |
| Binding Sites: | 1hwt_E 1hwt_F |
| Publications: | King D.A, Zhang L, Guarente L, Marmorstein R. Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein. Nature structural biology 6:64-71 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.