Transcription Factor
Accessions: | 4r2p_A (3D-footprint 20241219) |
Names: | Wilms tumor protein, isoform 4/CRA_a, WT1_HUMAN, WT33 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P19544 |
Length: | 89 |
Pfam Domains: | 5-29 Zinc finger, C2H2 type 5-29 C2H2-type zinc finger 22-46 Zinc-finger double domain 35-57 Zinc finger, C2H2 type 35-55 Zinc-finger of C2H2 type 35-57 C2H2-type zinc finger 49-75 Zinc-finger double domain 63-85 C2H2-type zinc finger 63-87 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 SEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGE 60 61 KPFSCRWPSCQKKFARSDELVRHHNMHQR |
Interface Residues: | 17, 18, 19, 20, 21, 23, 24, 45, 46, 47, 48, 49, 51, 52, 75, 76, 77, 78, 79, 81, 82 |
3D-footprint Homologues: | 7y3l_A, 1tf3_A, 7n5w_A, 8cuc_F, 8ssu_A, 2gli_A, 1tf6_A, 2jpa_A, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 2kmk_A, 6u9q_A, 2drp_D, 5v3j_F, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 8gn3_A, 7txc_E |
Binding Motifs: | 4r2p_A gCGTGGGGt |
Binding Sites: | 4r2p_B 4r2p_C |
Publications: | Hashimoto H, Olanrewaju Y.O, Zheng Y, Wilson G.G, Zhang X, Cheng X. Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Genes & development 28:2304-13 (2014). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.