Transcription Factor

						

			
Accessions: 1ubd_C (3D-footprint 20231221)

			
Names: Delta transcription factor, INO80 complex subunit S, NF-E1, Transcriptional repressor protein YY1, TYY1_HUMAN, Yin and yang 1, YY-1, YY1 ZINC FINGER DOMAIN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P25490
Length: 114
Pfam Domains:      3-26 C2H2-type zinc finger
     4-26 Zinc finger, C2H2 type
    19-41 Zinc-finger double domain
    31-53 C2H2-type zinc finger
    31-53 Zinc finger, C2H2 type
    46-71 Zinc-finger double domain
    59-83 C2H2-type zinc finger
    59-83 Zinc finger, C2H2 type
   75-101 Zinc-finger double domain
   89-113 C2H2-type zinc finger
   89-113 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQ   60
  61 CTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHA
Interface Residues: 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 53, 67, 71, 72, 73, 74, 75, 77, 78, 82, 99, 101, 102, 103, 104, 105, 106, 107, 108
3D-footprint Homologues: 7w1m_H, 5yel_A, 6wmi_A, 5ei9_F, 6ml4_A, 5v3j_F, 8gn3_A, 7eyi_G, 4m9v_C, 6e94_A, 7ysf_A, 2i13_A, 2jpa_A, 1ubd_C, 8ssq_A, 8ssu_A, 5kkq_D, 1tf3_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 4x9j_A, 1mey_C, 7txc_E, 5kl3_A, 2drp_D, 2kmk_A, 5und_A, 2gli_A, 1tf6_A, 6blw_A, 8h9h_G, 2lt7_A, 7y3m_I, 6a57_A, 4gnx_Z, 3uk3_C, 6u9q_A, 1f2i_J, 5yj3_D, 1g2f_F, 5k5i_A, 1llm_D, 2wbs_A
Binding Motifs: 1ubd_C CAAAATGGtGAA
Binding Sites: 1ubd_A
1ubd_B
			
Publications: Houbaviy H.B, Usheva A, Shenk T, Burley S.K. Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator. Proceedings of the National Academy of Sciences of the United States of America 93:13577-82 (1996). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.