Transcription Factor

Accessions: 1ubd_C (3D-footprint 20250804)
Names: Delta transcription factor, INO80 complex subunit S, NF-E1, Transcriptional repressor protein YY1, TYY1_HUMAN, Yin and yang 1, YY-1, YY1 ZINC FINGER DOMAIN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P25490
Length: 114
Pfam Domains: 3-26 C2H2-type zinc finger
4-26 Zinc finger, C2H2 type
19-41 Zinc-finger double domain
31-53 C2H2-type zinc finger
31-53 Zinc finger, C2H2 type
46-71 Zinc-finger double domain
59-83 C2H2-type zinc finger
59-83 Zinc finger, C2H2 type
75-101 Zinc-finger double domain
89-113 C2H2-type zinc finger
89-113 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQ 60
61 CTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHA
Interface Residues: 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 53, 67, 71, 72, 73, 74, 75, 77, 78, 82, 99, 101, 102, 103, 104, 105, 106, 107, 108
3D-footprint Homologues: 7w1m_H, 8gn3_A, 5ei9_F, 6ml4_A, 5v3j_F, 5yel_A, 4m9v_C, 6e94_A, 7ysf_A, 2jpa_A, 1ubd_C, 8ssu_A, 5kkq_D, 8ssq_A, 7y3l_A, 7n5w_A, 6jnm_A, 1tf3_A, 8cuc_F, 2gli_A, 1tf6_A, 4x9j_A, 5kl3_A, 7txc_E, 2kmk_A, 2drp_D, 6blw_A, 8h9h_G, 7y3m_I, 2lt7_A, 6a57_A, 4gnx_Z, 3uk3_C, 1f2i_J, 2wbs_A, 5yj3_D, 1g2f_F, 1llm_D, 5k5i_A, 6u9q_A
Binding Motifs: 1ubd_C CAAAATGGtGAA
Binding Sites: 1ubd_A
1ubd_B
Publications: Houbaviy H.B, Usheva A, Shenk T, Burley S.K. Cocrystal structure of YY1 bound to the adeno-associated virus P5 initiator. Proceedings of the National Academy of Sciences of the United States of America 93:13577-82 (1996). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.