Transcription Factor

Accessions: 2han_A (3D-footprint 20231221)
Names: Chorion factor 1, Nuclear receptor subfamily 2 group B member 4, Protein ultraspiracle, USP_DROME, XR2C
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20153
Length: 78
Pfam Domains: 3-71 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCR 60
61 YQKCLTCGMKREAVQEER
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54, 76, 78
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B
Binding Motifs: 2han_A kGAACc
2han_AB GGTTCAnTncaC
Binding Sites: 2han_C
2han_D
Publications: Jakób M, Kołodziejczyk R, Orłowski M, Krzywda S, Kowalska A, Dutko-Gwóźdź J, Gwóźdź T, Kochman M, Jaskólski M, Ozyhar A. Novel DNA-binding element within the C-terminal extension of the nuclear receptor DNA-binding domain. Nucleic acids research 35:2705-18 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.