Transcription Factor

Accessions: 4atk_B (3D-footprint 20260701)
Names: MICROPHTHALMIA-ASSOCIATED TRANSCRIPTION FACTOR, MITF_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q08874
Length: 60
Pfam Domains: 1-54 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 KKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRA 60
Interface Residues: 2, 5, 6, 8, 9, 10, 12, 13, 37, 39
3D-footprint Homologues: 1a0a_B, 7ssa_L, 5v0l_A, 4zpk_A, 8hov_A, 7d8t_A, 5eyo_A, 1am9_A, 8ia3_B, 7f2f_B, 5nj8_D, 4h10_A, 7xi3_A, 6g1l_A, 5gnj_I, 8osl_O, 7rcu_E, 5sy7_B, 4h10_B, 5i50_B, 8osl_P, 1an4_A, 2ypa_A, 5nj8_C, 2ypa_B, 6od3_F, 7xhv_B, 7xi3_B, 5v0l_B
Binding Motifs: 4atk_AB AGCACGTGC
4atk_B CGTGc
Binding Sites: 4atk_C / 4atk_D
Publications: Pogenberg V, Ogmundsdóttir M.H, Bergsteinsdóttir K, Schepsky A, Phung B, Deineko V, Milewski M, Steingrímsson E, Wilmanns M. Restricted leucine zipper dimerization and specificity of DNA recognition of the melanocyte master regulator MITF. Genes & development 26:2647-58 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.