Transcription Factor
| Accessions: | LMX1A_DBD (HumanTF 1.0), LMX1A (HT-SELEX2 May2017) |
| Names: | LIM homeobox transcription factor 1-alpha, LIM/homeobox protein 1.1, LIM/homeobox protein LMX1A, LMX-1.1, LMX1A, LMX1A_HUMAN, ENSG00000162761 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q8TE12 |
| Notes: | Ensembl ID: ENSG00000162761; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Znf_LIM_Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Znf_LIM_Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 120 |
| Pfam Domains: | 44-100 Homeobox domain 68-96 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 ELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAFKA 60 61 SFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQQNTQRLSS 120 |
| Interface Residues: | 43, 44, 45, 46, 47, 85, 86, 88, 89, 92, 93, 96, 97, 100 |
| 3D-footprint Homologues: | 3d1n_M, 1ig7_A, 6a8r_A, 3cmy_A, 2h1k_B, 1fjl_B, 1nk2_P, 5zfz_A, 6m3d_C, 1jgg_B, 3lnq_A, 2lkx_A, 1zq3_P, 7q3o_C, 6es3_K, 3l1p_A, 2hos_A, 2d5v_B, 5hod_A, 1au7_A, 3rkq_B, 4xrs_G, 2hdd_A, 1b72_A, 4cyc_A, 2r5y_A, 2ld5_A, 5jlw_D, 2xsd_C, 1e3o_C, 1le8_A, 7xrc_C, 5flv_I, 1o4x_A, 8g87_X, 1du0_A, 5zjt_E, 4qtr_D, 7psx_B, 1puf_A, 4xrm_B, 1puf_B |
| Binding Motifs: | LMX1A_DBD tTAATTAa LMX1A_3 yTAATTAm LMX1A_methyl_1 yTAATTRc LMX1A_methyl_2 ywCrTTAw |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.