Transcription Factor
Accessions: | 3uk3_C (3D-footprint 20231221), 4f2j_C (3D-footprint 20231221), 4is1_C (3D-footprint 20231221) |
Names: | Zinc finger protein 217, ZN217_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | O75362 |
Length: | 52 |
Pfam Domains: | 2-23 Zinc finger, C2H2 type 2-23 C2H2-type zinc finger 16-39 Zinc-finger double domain 29-52 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 RECSYCGKFFRSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHH |
Interface Residues: | 9, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 24, 26, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50 |
3D-footprint Homologues: | 8gn3_A, 3uk3_C, 7ysf_A, 2kmk_A, 1tf3_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 5ei9_F, 1mey_C, 7txc_E, 6e94_A, 5kl3_A, 1f2i_J, 6wmi_A, 5k5i_A, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 2lt7_A, 1tf6_A, 6ml4_A, 5v3j_F, 4x9j_A, 1llm_D, 6blw_A, 5kkq_D, 8ssu_A, 1ubd_C, 6u9q_A, 8h9h_G, 4m9v_C, 7eyi_G, 7w1m_H, 8ssq_A, 2i13_A, 8gh6_A, 7y3m_I, 6a57_A, 2jpa_A, 1yuj_A, 5yj3_D, 2wbs_A, 5yel_A |
Binding Motifs: | 4f2j_C TGcaG 3uk3_C TTCTGCA 3uk3_CD TGCAGAATnnATTCTGCA 4is1_CD TGCAGAATnnATTCTGCA |
Binding Sites: | 3uk3_A / 3uk3_B 4f2j_A |
Publications: | Vandevenne M, Jacques D.A, Artuz C, Nguyen C.D, Kwan A.H, Segal D.J, Matthews J.M, Crossley M, Guss J.M, Mackay J.P. New insights into DNA recognition by zinc fingers revealed by structural analysis of the oncoprotein ZNF217. The Journal of biological chemistry 288:10616-27 (2013). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.