Transcription Factor
| Accessions: | ZNF740_DBD (HumanTF 1.0), ZNF740 (HT-SELEX2 May2017) |
| Names: | OriLyt TD-element-binding protein 7, Zinc finger protein 740, ZN740_HUMAN, ZNF740, ENSG00000139651 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q8NDX6 |
| Notes: | Ensembl ID: ENSG00000139651; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4 |
| Length: | 113 |
| Pfam Domains: | 21-43 Zinc finger, C2H2 type 21-43 C2H2-type zinc finger 35-58 Zinc-finger double domain 49-71 Zinc finger, C2H2 type 49-71 C2H2-type zinc finger 63-87 Zinc-finger double domain 77-99 Zinc finger, C2H2 type 77-98 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 KAVVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHILIHTGEKPFECDICDMRFIQ 60 61 KYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGCQSKTSDGQFSL |
| Interface Residues: | 21, 31, 32, 33, 34, 35, 37, 38, 59, 60, 61, 62, 63, 65, 66, 67, 88, 89, 90, 91, 92, 93, 94, 95 |
| 3D-footprint Homologues: | 2kmk_A, 7y3l_A, 7n5w_A, 6jnm_A, 3uk3_C, 5v3j_F, 1tf3_A, 8cuc_F, 4x9j_A, 2gli_A, 8ssu_A, 5kkq_D, 1tf6_A, 8gn3_A, 5ei9_F, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 5k5i_A, 7ysf_A, 6ml4_A, 8ssq_A, 7w1m_H, 5k5l_F, 6u9q_A, 8h9h_G, 6e94_A, 7y3m_I, 2lt7_A, 6a57_A, 6blw_A, 5yel_A, 1f2i_J, 2wbs_A, 5yj3_D, 7txc_E, 1llm_D, 2drp_D, 4m9v_C |
| Binding Motifs: | ZNF740_DBD mCCCCCCCAc ZNF740_2 cygCCCCCCCCAC ZNF740_4 cyrCCCCCCCCAc ZNF740_methyl_1 cygCCCCCCCCAC ZNF740_methyl_3 cygCCCCCCCCaC |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.