Transcription Factor
| Accessions: | 4egy_B (3D-footprint 20260701), 4h0e_A (3D-footprint 20260701), 5d4s_A (3D-footprint 20260701) |
| Names: | Arabinose metabolism transcriptional repressor, ARAR_BACSU |
| Organisms: | Bacillus subtilis, strain 168 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P96711 |
| Length: | 70 |
| Pfam Domains: | 6-69 Bacterial regulatory proteins, gntR family 33-67 DeoR-like helix-turn-helix domain 33-64 HTH domain |
| Sequence: (in bold interface residues) | 1 EFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLY 60 61 SVQGGGTFVA |
| Interface Residues: | 7, 31, 32, 33, 36, 42, 43, 44, 45, 46, 47, 48, 63, 64 |
| 3D-footprint Homologues: | 7zla_B, 6wg7_G, 4wwc_B, 4h0e_A, 4p9u_F, 1h9t_B, 4u0y_B, 6za3_B |
| Binding Motifs: | 4egy_AB TGyACGAaCA 4egy_B TCgnaCA 4h0e_A TGwnyG 4h0e_AB TGtaCGGaCA 5d4s_A CGTATGT 5d4s_AB CrtACGnaCA |
| Binding Sites: | 4egy_T 4egy_U 4h0e_T 4h0e_U 5d4s_T 5d4s_U |
| Publications: | Jain D, Nair D.T. Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators. Nucleic acids research 41:639-47 (2013). [Pubmed] Jain D, Narayanan N, Nair DT. Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators. J Biol Chem 291:1235-42 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.